KEGG   Burkholderia phymatum: Bphy_6083Help
Entry
Bphy_6083         CDS       T00704                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bph  Burkholderia phymatum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bphy_6083
Enzymes [BR:bph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Bphy_6083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBPHY01:complement(626687..627637)
Genome map
AA seq 316 aa AA seqDB search
MTGTDLAQMQQPRFAGIPTFMRVPFSTDPNTFDIALAGVPFDGGVTARPGARFGPREIRN
MSTMMRGIHHVTRFNPFDACRVADIGDVPFTDLYHLERAHDDIRRFFEPVFRAGKLALTA
GGDHSITYPIFQALAPREPVALVHIDAHTDTWDSFKGSKFTHGAPFRRAVEAGLLDPKRT
IQIGIRGAQNSDEGWRYSLDHGMRVVFIEEFDVLGPAAVAAEARRIVGDAPVYLSLDVDG
LDPVFAPGTGTPEVGGLTTRETQALLRGLDGLNWVGGDVVEVSPPYDPSGNTALVAATLM
YEILCLLAKRASEANR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggaaccgatctggcacagatgcagcagccgcgcttcgcgggcatcccgaccttc
atgcgcgtgccgttcagcacggacccgaacaccttcgacattgcgctcgcaggcgtgccc
ttcgacggcggcgtcacggcgcgaccgggtgcgcgcttcggtccgcgcgaaatccgcaat
atgtccacgatgatgcgcggtatccatcacgtgacgcgcttcaatccgttcgacgcctgc
cgcgttgccgatatcggcgatgtgccgttcaccgatctctatcatctcgaacgcgcgcac
gatgacatccgccgcttcttcgagccggtgttccgcgcgggtaagctcgcgctgacggcg
ggcggcgatcactcgatcacctacccgatcttccaggcgctggcgccgcgcgaacccgtc
gcgctggtgcatatcgacgcgcacaccgacacctgggattcgttcaaaggctcgaaattc
acgcacggcgcgccatttcgccgtgcagtcgaagctggtctgctcgacccgaagcggacc
attcagatcggcattcgcggtgcgcagaattcggacgaaggctggcgttattcgctcgat
cacggcatgcgcgtggtgttcatcgaagagttcgacgtgctcgggccggccgccgtcgcg
gccgaggcgcggcgcatcgtcggcgatgcgcccgtttatctgtcgctcgatgtcgatggg
ctcgaccctgtgttcgcgccgggcacgggcacgccggaagtgggcggtcttacgacccgc
gagacgcaggcgctgctgcgcggtctcgacggactcaactgggtcggcggcgacgtggtc
gaagtctcaccgccttacgatccgagcggcaacaccgcgctcgtcgccgcgacgctgatg
tacgaaattctgtgcctgctcgcgaagcgcgcgagcgaggcaaaccgctag

DBGET integrated database retrieval system