KEGG   Burkholderia phymatum: Bphy_6399Help
Entry
Bphy_6399         CDS       T00704                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bph  Burkholderia phymatum
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bph00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bphy_6399
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bphy_6399
Enzymes [BR:bph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Bphy_6399
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bphy_6399
Two-component system [BR:bph02022]
 CheA family
  CheA-CheYBV
   Bphy_6399
Bacterial motility proteins [BR:bph02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bphy_6399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBPHY01:974947..979032
Genome map
AA seq 1361 aa AA seqDB search
MPKKRAQTLPSQANFPIVGIGASAGGLSALREFFEALPAHTSMAFVVIVHLAPDHESNLA
SLLQKTTDMPVLEVTSATPIEPDHVYLIAPSLELTMVDDYLRVMPRQPDDGRRAAIDLFF
RTLAEAHRERAIGIVLSGAGSDGSVGLSRVKEMGGITLAQDPAEAEYDSMPRSAIATGMV
DFVLTAAEMPQRLLDLWLTTKEIHLPIAEGDERDETISNESAERALREIMVILRTRTGHD
FRHYKRATVLRRIERRMQVNGITDLQAYRDHLHLHQDETQALLQDMLISVTNFFRDKEAF
EVLEREVLPQLFEGRGEQDRIRTWSVGCATGEEAYSLAMLLQERSLKSAEGVSFQVFATD
IDERAISFARAGLYPDSILADVSTSRVRQFFSKDAAHYRVKKELREHMLFAHHNVLSDPP
FSRLDLICCRNLLIYLDREAQIEILKMFHFALRPGGVLFLGSSESADSVSSMFSVIDKRN
RIYRANMAVRGDTPVPVAISGMASARPVVATVQPPGRRRFSFGDLHQRLVEQYAPPSVLV
SRDSEIVHLSDRAGRFLQYSGGEPSHNIVAVVRPELRLELRTAIYQALHTNRSVEARRVR
IEHEGRSYFVNMTARPVHDPEANADFVLVLFDEVEDSMGGSETSASDAQKDPIISQLERE
LQRTKEQLQSTIEQSETSTEELKASNEELQAINEELRSATEELETSKEELQSINEELTTV
NAELKSKVEETGKINDDLQNLIAANDIGTIFVDRNICIKRYTPRATDVFSIIPSDIGRSL
LDITHRLEYDKLADDAAEAFDSLRLIERELKSNDGRWYLARFVPYRTTEDRIDGAVLSFI
DITGRRQAEDRLREGERRMRIVAEGTKDYAIITFDDEGLVTSWNAGAERIFGYTEAEMIG
QSADMLSTEEDRASNIAQAEFAEARLNGRTEEERWHVRKDGTRFFASGVLSRLDEAGVSG
FAKIARDLGEFGHVATTERGSHTETLRAAAERDAQRRRDEFLAVVSHELKHPLNLISASA
ELIARAPETRQSLNISRAADTIRRTVIGQAQIIDDLLDISRVRTGKLSIIRTAVDMREIV
QRVCNAVQDDARQRGLTLNVTMAESPVIIHADLTRVEQVVWNLVSNAMKFTNRGSVDVSL
RVNEHGEAVLRVSDTGKGIEPSLLPHIFEMFEQSRDPVTRRSGLGIGLALVRELVNLHGG
AVRAESEGVGRGSTFTVTLPTHRTLSYASGADGDAAVDSLRGVRVLMVDDDAATTETFKL
LLESEGAIVKTAASGEEALAMLNGDVPDVVLSDIGMHGMDGLEFVGKLREEPGLKSVICI
ALSGFGQEADVKMAENAGFDAHLKKPVMLEDLLHVVSRLRH
NT seq 4086 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaaaacgtgcacagacactgcccagccaggccaacttcccaatcgtgggcatt
ggcgcttctgcgggtggactgagcgcactccgggagttcttcgaagcgttgcccgcccac
acgtcgatggccttcgtggtgattgtccatctggcgcccgatcacgaaagcaatctcgcc
tcgcttctccagaagaccactgacatgcccgtgctggaagtcacgagcgccacacccatc
gaacccgaccatgtgtacctgatcgcgccttcgctcgagctgacgatggtcgacgactat
ctgcgggtcatgccgaggcaaccggacgatggccgccgcgcggcgatcgatctgttcttc
cgtacgcttgcggaagctcatcgagagcgcgcaatcggcatcgtgctgtcgggtgcgggt
tcggacggctcggtcggactgtcgcgcgtcaaggagatgggcggcatcacgctcgcccag
gaccccgccgaggccgaatacgacagcatgccgcgcagcgcgatcgcgacgggcatggtc
gatttcgtgctgaccgcggccgaaatgccgcagcgcctgctcgatctgtggctgacgacc
aaggagattcatctgcccatcgccgagggcgacgagcgcgatgaaaccatctcgaacgag
tccgccgaacgcgcgctgcgtgaaatcatggtcatcctgcgcacgcgcacgggccacgac
ttccgccactacaagcgggccaccgttctgcgccgcatcgagcggcgcatgcaggtcaac
ggcatcacggatctccaggcctaccgcgaccacttgcacctgcatcaggacgaaacccag
gcgctgctgcaggacatgctgatcagcgtgaccaacttcttccgcgacaaggaagcgttc
gaggtgctcgagcgcgaagtgctgccgcaactgttcgaagggcgcggcgagcaggaccgg
attcgcacgtggtcggtcggctgcgcaacgggcgaagaggcctattcgctggccatgctg
ctgcaggagcgctcgttgaaatcggcggagggcgtctcgttccaggtgttcgccaccgac
atcgacgagcgggccatttcgttcgcgcgcgcaggcctctatcccgactccattctcgcc
gacgtgagcacgtcccgcgtgcgccagttcttttcaaaagacgctgcgcactatcgtgtg
aagaaggaactgcgcgagcacatgctgttcgcgcatcacaacgtgctgagcgacccgccc
ttctctcggctcgacctgatctgctgccgcaatctgctgatctatctcgaccgggaagcg
cagatcgagattctgaagatgttccactttgcgctgcggccgggtggcgtgctgtttctc
ggcagttccgaatcggccgacagcgtgagctcgatgttcagcgtgatcgacaagcgtaac
cgcatctaccgcgcgaacatggcggtgcgcggcgatacgcccgtgcctgtcgcgatctcc
ggcatggcgagcgcgcggcccgtcgtggcgacggtgcagccgccgggacgccgccgcttc
tcgttcggcgacctgcatcaacgcctcgtcgaacaatatgcgccgcccagcgtgctggtg
agccgcgactccgaaatcgttcatctgtccgatcgcgcgggccgcttcctgcagtattcg
ggcggcgaaccgtcgcacaacatcgtcgccgtggtgcgccccgaactcaggctcgaattg
cgcaccgcgatctatcaggcgctgcacacgaatcgcagcgtcgaagcgcgccgcgtgcgg
atcgagcacgagggccgatcgtacttcgtcaacatgacggcgcgccccgtgcacgatccg
gaagcgaatgcagacttcgtgctggtgctgttcgacgaagtcgaagacagcatgggcggc
tcggaaacgtcggcgtccgacgcgcagaaagaccccatcatcagccagctcgaacgcgag
ctgcaacgcacgaaggaacagttgcagtcgaccatcgaacaatcggaaacgtcgacggaa
gaactgaaggcctccaacgaagaattgcaggcgatcaacgaggaactgcgctcggcgacg
gaagagctcgaaacgagcaaggaagaactgcagtcgatcaacgaagagctcaccacggtc
aacgcggaactcaagtcgaaggtcgaggaaacaggcaagatcaacgacgacttgcagaac
ctgatcgccgccaacgacatcggcacgatcttcgtcgaccgcaatatctgcatcaagcgc
tacacgccgcgcgccacggacgtgttcagcatcatcccgtctgacatcgggcgctcgctg
ctcgacatcacgcaccggctcgaatacgacaagctcgccgacgacgctgcggaagcgttc
gactccctgcgcctgatcgagcgcgagctgaagagcaacgacggccgctggtatctcgcg
cgcttcgtgccttatcgcacgacggaagaccgcatcgacggcgccgtgctgtcgttcatc
gacatcacgggccgccgccaggcggaagaccgtctgcgcgaaggcgagcggcgcatgcgc
atcgtcgcggaaggcaccaaggactacgcgatcatcacgttcgacgacgaaggcctcgtc
acgagctggaatgcgggcgctgaacggatcttcggctacacggaggccgaaatgatcggc
cagtccgccgacatgctgtccaccgaagaggaccgcgccagcaatattgcgcaggcagaa
ttcgcggaagcgcggctgaacggccgcaccgaggaggaacggtggcacgtgcgcaaggac
ggcacacgcttcttcgcgagcggcgtcctgtcgcgtctggacgaagcgggcgtcagcggt
ttcgcgaagatcgcacgcgatctcggcgaattcggccacgtcgcgacgaccgaacggggc
agccacaccgaaacgctgcgcgccgccgccgagcgcgatgcgcagcggcgccgcgacgag
tttctcgctgtcgtgtcgcacgaactgaagcatcccctcaatctgatctccgccagcgcg
gaactgatcgcgcgcgcgccggaaacgcggcagagcctgaacatctcgcgcgcggccgac
acgatccgccgcacggtgatcggccaggcgcagatcatcgacgatctgctcgacatctcg
cgcgtgcgcacgggcaagctgtccatcatacgcaccgccgtcgatatgcgcgaaatcgtg
caacgcgtctgcaatgccgttcaggatgacgcgcggcagcgcgggctcaccctcaatgtc
acgatggcggagtcgcccgtcatcatccatgccgatctgacgcgcgtcgaacaggtggtc
tggaacctggtcagcaacgcaatgaagttcacgaaccgcggttccgtggatgtctcgctg
cgagtcaacgagcatggcgaggccgtgctgcgcgtgtcggacacgggcaagggcatcgag
ccctcgctgctgccgcatatcttcgagatgttcgagcagagccgcgatcccgtaacgcgc
cgctcgggcctcggcatcggcctcgcgctggtcagggagctcgtgaatctccacggcggc
gccgtgcgggcggaatcggaaggcgtgggccgcggctcgacgttcacggtcacgctgccg
acgcatcgcacgctttcgtatgcgagcggcgccgacggcgacgccgcggtcgattcgttg
cgcggtgtccgggttctgatggtcgacgacgacgcggcaaccacggaaaccttcaaactg
ttgctcgaaagcgaaggtgcaatcgtgaagaccgccgccagcggcgaagaagcgttggcg
atgctcaatggcgacgtacccgatgtcgtcctgtccgatatcggcatgcatggcatggac
gggttagagttcgtcggcaagctgcgcgaagaacctgggctcaaatccgtgatctgcatc
gcgctcagcggtttcggccaggaagccgatgtgaagatggcggaaaacgccggcttcgat
gcgcacctgaagaaacccgtgatgctcgaagatctgctccatgtggtctcgcgcttgcgg
cattag

DBGET integrated database retrieval system