KEGG   Burkholderia phymatum: Bphy_6610Help
Entry
Bphy_6610         CDS       T00704                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bph  Burkholderia phymatum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphy_6610
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphy_6610
   00630 Glyoxylate and dicarboxylate metabolism
    Bphy_6610
Enzymes [BR:bph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bphy_6610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBPHY01:1198904..1201084
Genome map
AA seq 726 aa AA seqDB search
MTQMTQRGGLQVAANLEQFIEKEALPGTGVDSAAFWAGFDAIVHDLAPKNRALLAERDRL
QVELDTWHRANPGPVRDLRAYRGFLESIGYIVPTPASVKATTDNVDSEIAEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIDETDGAERTAKFNPVRGARVIAFARKFLDDAA
PLENGSHKDSTGYRVENGKLSVALKSGATALRDPAQFVGYQGDANAPSAVLLKHNGLHFE
IQIDADDSIGKTDPANIKDVLMEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMVGNLT
EEVTKGGKTFTRRLNADREYHGADGKPVKLHGRSLLFIRNVGHLMTNPAVLDRDGNEIPE
GILDGVVTTLCALHDRTHKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLGLARNT
IKMGIMDEERRTSVNLAACIAEAAQRVAFINTGFLDRTGDEMHSSMEAGPMMRKGDMKSS
KWIAAYERSNVLVGLAAGLRGRAQIGKGMWAMPDLMKAMLEQKIGHPKAGANTAWVPSPT
AATLHALHYHQVDVQAVQKELERTDLASVRDELLDGLLTIPVVEKAQWSDTEIRQEIENN
AQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLRHGVVRQELVLET
LKLMAKVVDQQNAGDPGYKPMAPDFDRSIAFKAACALVFEGCAQPSGYTEPLLHKFRLQL
KEAGNA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaatgacccaacgcggcggattgcaggtcgccgcgaacctcgaacagttcatc
gaaaaggaagccctgccaggaaccggtgtcgatagcgccgcgttctgggccggtttcgat
gccatcgtgcacgatctcgcgccgaagaaccgcgcactgctcgccgaacgcgaccgcctg
caggtcgaactggatacctggcatcgcgccaatcccggcccggtgcgcgacctgcgcgca
taccgcggcttcctggagagcatcggctatatcgtgccgacgcctgcgagtgtaaaagcc
accaccgacaacgtcgacagcgaaatcgccgaacaggcgggtccacagctcgtcgtgccg
ctgtcgaaccagcgttacgcgctgaatgccgccaacgcgcgctggggtagcttgtatgac
gcgctgtacggcacggatgccatcgacgaaacggacggcgccgagcgcaccgcgaagttc
aacccggtgcgcggcgcacgcgtgatcgcgttcgcgcgcaagttcctcgacgacgccgcg
ccgctcgaaaacggttcgcacaaggactcaaccggctaccgcgtcgagaacggcaagctg
agcgtcgcgctgaagagcggcgcgacggcgctgcgagacccggctcaattcgtcggctat
cagggcgacgcgaatgcgccgtccgccgtgctgctcaagcacaacggcctgcacttcgaa
atccagatcgacgctgacgattcgatcggcaagaccgaccccgcgaacatcaaagacgtg
ctcatggaagcggccgtcagcacgattatcgattgcgaagactcggtcgccgccgtcgat
gccgacgacaaggtgcagctctatcgcaactggctcggcctgatggtcggcaatctgacg
gaagaagtcacgaagggcggcaagaccttcacgcgccgcctgaacgcggaccgcgaatat
cacggcgcagatggcaagccggtgaagctgcatggccgctcgctgctgttcatccgcaac
gtcggccatctgatgacgaacccggccgtgctcgaccgcgacggcaacgagatccccgaa
ggcattctggatggcgtcgtcacgacgctgtgcgcgctgcacgaccgcacgcacaagctc
aattcgcgcacgggctcgatctacatcgtcaagccgaagatgcacggccccgctgaagtt
gcgttcgcgagcgagctgttcgcgcgcgtcgaagatctgctcggccttgcgcgcaacacg
atcaagatgggcatcatggatgaggagcgccgcacgagcgtgaaccttgccgcatgtatc
gccgaagcggcgcagcgcgttgcgttcatcaacacgggcttcctggaccggacgggcgac
gagatgcacagttcgatggaagccggcccgatgatgcgcaagggcgacatgaagtcgagc
aagtggattgccgcgtatgagcgcagcaacgtgctggtcggcctcgctgcggggctgcgc
ggccgcgcgcagatcggcaagggcatgtgggcgatgcccgatctgatgaaggcgatgctc
gaacagaagatcggacatccgaaggcgggcgcgaacacggcatgggtgccctcgcccacg
gccgcgacgctgcatgcgctgcactaccaccaggtcgacgtgcaggcagtgcagaaggaa
ctcgaacgcacggatcttgcgagtgtgcgcgacgagctgctggacggcctgctgactatc
cccgtcgtcgaaaaagcgcagtggagcgacaccgaaattcgccaggaaatcgagaacaac
gcgcaaggcattctcggctatgtggtgcgctggatcgatcagggtgtcggctgctcgaag
gtgccggatattcataatgtcggcctgatggaagaccgtgccacgctgcgcatctcgagc
cagcacatcgcgaactggctgcgtcatggtgtggtcaggcaggagctcgtgctggaaacg
ctcaagctgatggcgaaggtcgtcgaccagcaaaatgcgggcgatccgggctacaagccg
atggcgcctgacttcgacaggtcgattgcgttcaaggcggcgtgcgcgctggtgttcgaa
ggctgcgcgcagcctagcggctatacggaaccgctgttgcacaagttccgtctgcaactg
aaggaagccggcaacgcctga

DBGET integrated database retrieval system