KEGG   Paraburkholderia phymatum: Bphy_6610Help
Entry
Bphy_6610         CDS       T00704                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00620  Pyruvate metabolism
bph00630  Glyoxylate and dicarboxylate metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01200  Carbon metabolism
Module
bph_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphy_6610
   00630 Glyoxylate and dicarboxylate metabolism
    Bphy_6610
Enzymes [BR:bph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bphy_6610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACC75638
JGI: Bphy6610
UniProt: B2JST5
Position
pBPHY01:1198904..1201084
Genome map
AA seq 726 aa AA seqDB search
MTQMTQRGGLQVAANLEQFIEKEALPGTGVDSAAFWAGFDAIVHDLAPKNRALLAERDRL
QVELDTWHRANPGPVRDLRAYRGFLESIGYIVPTPASVKATTDNVDSEIAEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIDETDGAERTAKFNPVRGARVIAFARKFLDDAA
PLENGSHKDSTGYRVENGKLSVALKSGATALRDPAQFVGYQGDANAPSAVLLKHNGLHFE
IQIDADDSIGKTDPANIKDVLMEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMVGNLT
EEVTKGGKTFTRRLNADREYHGADGKPVKLHGRSLLFIRNVGHLMTNPAVLDRDGNEIPE
GILDGVVTTLCALHDRTHKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLGLARNT
IKMGIMDEERRTSVNLAACIAEAAQRVAFINTGFLDRTGDEMHSSMEAGPMMRKGDMKSS
KWIAAYERSNVLVGLAAGLRGRAQIGKGMWAMPDLMKAMLEQKIGHPKAGANTAWVPSPT
AATLHALHYHQVDVQAVQKELERTDLASVRDELLDGLLTIPVVEKAQWSDTEIRQEIENN
AQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLRHGVVRQELVLET
LKLMAKVVDQQNAGDPGYKPMAPDFDRSIAFKAACALVFEGCAQPSGYTEPLLHKFRLQL
KEAGNA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaatgacccaacgcggcggattgcaggtcgccgcgaacctcgaacagttcatc
gaaaaggaagccctgccaggaaccggtgtcgatagcgccgcgttctgggccggtttcgat
gccatcgtgcacgatctcgcgccgaagaaccgcgcactgctcgccgaacgcgaccgcctg
caggtcgaactggatacctggcatcgcgccaatcccggcccggtgcgcgacctgcgcgca
taccgcggcttcctggagagcatcggctatatcgtgccgacgcctgcgagtgtaaaagcc
accaccgacaacgtcgacagcgaaatcgccgaacaggcgggtccacagctcgtcgtgccg
ctgtcgaaccagcgttacgcgctgaatgccgccaacgcgcgctggggtagcttgtatgac
gcgctgtacggcacggatgccatcgacgaaacggacggcgccgagcgcaccgcgaagttc
aacccggtgcgcggcgcacgcgtgatcgcgttcgcgcgcaagttcctcgacgacgccgcg
ccgctcgaaaacggttcgcacaaggactcaaccggctaccgcgtcgagaacggcaagctg
agcgtcgcgctgaagagcggcgcgacggcgctgcgagacccggctcaattcgtcggctat
cagggcgacgcgaatgcgccgtccgccgtgctgctcaagcacaacggcctgcacttcgaa
atccagatcgacgctgacgattcgatcggcaagaccgaccccgcgaacatcaaagacgtg
ctcatggaagcggccgtcagcacgattatcgattgcgaagactcggtcgccgccgtcgat
gccgacgacaaggtgcagctctatcgcaactggctcggcctgatggtcggcaatctgacg
gaagaagtcacgaagggcggcaagaccttcacgcgccgcctgaacgcggaccgcgaatat
cacggcgcagatggcaagccggtgaagctgcatggccgctcgctgctgttcatccgcaac
gtcggccatctgatgacgaacccggccgtgctcgaccgcgacggcaacgagatccccgaa
ggcattctggatggcgtcgtcacgacgctgtgcgcgctgcacgaccgcacgcacaagctc
aattcgcgcacgggctcgatctacatcgtcaagccgaagatgcacggccccgctgaagtt
gcgttcgcgagcgagctgttcgcgcgcgtcgaagatctgctcggccttgcgcgcaacacg
atcaagatgggcatcatggatgaggagcgccgcacgagcgtgaaccttgccgcatgtatc
gccgaagcggcgcagcgcgttgcgttcatcaacacgggcttcctggaccggacgggcgac
gagatgcacagttcgatggaagccggcccgatgatgcgcaagggcgacatgaagtcgagc
aagtggattgccgcgtatgagcgcagcaacgtgctggtcggcctcgctgcggggctgcgc
ggccgcgcgcagatcggcaagggcatgtgggcgatgcccgatctgatgaaggcgatgctc
gaacagaagatcggacatccgaaggcgggcgcgaacacggcatgggtgccctcgcccacg
gccgcgacgctgcatgcgctgcactaccaccaggtcgacgtgcaggcagtgcagaaggaa
ctcgaacgcacggatcttgcgagtgtgcgcgacgagctgctggacggcctgctgactatc
cccgtcgtcgaaaaagcgcagtggagcgacaccgaaattcgccaggaaatcgagaacaac
gcgcaaggcattctcggctatgtggtgcgctggatcgatcagggtgtcggctgctcgaag
gtgccggatattcataatgtcggcctgatggaagaccgtgccacgctgcgcatctcgagc
cagcacatcgcgaactggctgcgtcatggtgtggtcaggcaggagctcgtgctggaaacg
ctcaagctgatggcgaaggtcgtcgaccagcaaaatgcgggcgatccgggctacaagccg
atggcgcctgacttcgacaggtcgattgcgttcaaggcggcgtgcgcgctggtgttcgaa
ggctgcgcgcagcctagcggctatacggaaccgctgttgcacaagttccgtctgcaactg
aaggaagccggcaacgcctga

DBGET integrated database retrieval system