KEGG   Burkholderia phymatum: Bphy_7031Help
Entry
Bphy_7031         CDS       T00704                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bph  Burkholderia phymatum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bph01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bph00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bph00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bph00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBPHY01:1697271..1698419
Genome map
AA seq 382 aa AA seqDB search
MIEFTLPSMGADMDEGTLLEWKIKPGDAVTKGQIVAIVDTSKAAVDIESWYEGTVYELIT
EPGEKIPVGTPMAIFLERGESASELKKRTGAISAAGSPLSVDAVAQRRKVSPAARKHAHE
CHVDLDSVVGSGPGGSVTYDDVEHARRGAADIRAAPAGDRLAAMRTVIASAMERSKREIP
HYYVSETIPLGTALKWLQAENARRSIDDRVLLAVLLLKAVAVTLKRFPELNGFYRAGSFL
SASKTHVGVAISLRHGGLVAPALLDTETKTLLQLMRELADLTKRCRAGSLRSSELSEATI
TVTNLGDQGTCEVFGVIYPPQVALVGFGRVIERPWAHNGEVTILPTVTATLSADHRVSDG
HRGALFLLELSDALQHPEELDR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagttcacgttgccttcgatgggagccgacatggacgaaggcacgctcctcgaa
tggaagataaagcccggtgacgcggtcaccaaaggtcagatcgtggccatcgtcgacacc
agcaaagcggccgtcgatatcgaaagctggtatgagggaacggtatacgaactgatcacg
gagcccggcgagaaaatacccgtgggcacgccgatggcaatttttctggagcgcggcgaa
tccgcgtcagaactgaagaagcgaacgggagcgatatccgcggcgggctccccgctgtct
gtcgatgccgttgcgcagcgccgcaaggtttcacctgcggcgcgcaagcacgctcacgaa
tgtcatgtcgacctcgacagcgtcgtgggtagcgggccgggcggttcggtgacatacgac
gacgtagaacacgccaggcgcggcgccgcggacatcagggctgcgcctgccggcgacagg
cttgcagcgatgagaaccgtgatcgcgagtgcgatggaacgctcgaaacgggaaattcct
cactactacgtcagcgaaacgatcccgctcggaacagcgctcaaatggcttcaggccgaa
aatgcgagacgctcgatcgatgatcgggtcttgcttgcagtcctgttactcaaagcggtg
gccgtaacgctgaaacgttttccggaactcaacggcttctatcgtgcaggctcattcctt
tcagccagcaagactcacgtcggggtggcgatctcattgcgccacggaggtctcgtcgcg
ccagccttgctcgacaccgagaccaagacgttactgcaactcatgcgggaactggccgat
ctcacgaaacgttgccgcgccggctctctgcgcagctccgaactgtcagaggccaccatt
accgtgacgaatctcggcgatcagggaacctgcgaagtgttcggcgtcatttacccacca
caggttgcgctggtcggatttggccgcgtcatcgaacgtccgtgggcacataatggcgaa
gtcacgatactccccacagtgacagccacgctgtcggccgaccaccgggtgtccgacggc
caccgtggcgcgctctttcttcttgaactgagcgatgccttgcaacatcctgaggagctc
gatcgatga

DBGET integrated database retrieval system