KEGG   Burkholderia phymatum: Bphy_7448Help
Entry
Bphy_7448         CDS       T00704                                 

Definition
cyclic nucleotide-binding protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bph  Burkholderia phymatum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bphy_7448
Enzymes [BR:bph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bphy_7448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBPHY02:complement(217467..218411)
Genome map
AA seq 314 aa AA seqDB search
MNATSRPLMFFGTTNLDLCFEVEHLPAAGESVMGTLARYAGGKGANQAVAAARLGAAPRF
FTRIGGDEAGDFLLRSLEEAGVIVDAVEIASGEPSGSALVAVGNDGSNVVIIDPGANRHI
TVASISHGASFISQDTVVVAEMGLPLPALEYLFSLKREVPFTLVFNPAPVQSGMSRDAWR
AVDIVTPNAAEASELTGIRVVDDKTARSAATALLGLGPRAVVITLGEQGSWYADIEQSFG
MPAFPVQAVDTTGAGDAFTGGLAAAIAMGHPIRSAICRAMAVAAISVTRHGAQIAMPSAR
EVDDFLQPIMSLES
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgacctcacgtcctctcatgttcttcggaaccacaaatctcgacttatgcttt
gaagtcgagcacctgcctgcggcaggcgaatcggtcatgggcacgctcgcccgctacgca
ggcggcaagggggccaatcaggcggtcgccgctgccaggcttggcgctgctccacgattt
tttacgcgaatcggtggcgacgaggcgggagacttcctgctgcgctcgctggaagaggct
ggcgtgatcgtggatgcagtcgagatcgcgtcgggagaaccgtccggatccgcactcgtg
gcagtaggcaatgacggcagcaacgtggtcatcatcgacccgggtgcaaaccggcacatc
acggttgcgagtatcagccatggcgcgagtttcatctcgcaggataccgttgtcgtcgca
gagatgggactgccactgccggctctcgaatacctgttctcgctaaaacgtgaagttccg
ttcacgctcgtcttcaaccctgcgcccgtgcaatcgggtatgagccgggatgcatggcgg
gccgtcgatatcgtcacgccaaatgcagcggaggcgtcggagctcacgggtatccgcgtc
gtggacgacaaaacggcgcgaagcgccgccactgccctgctcgggctgggtccccgcgct
gtcgtgatcacgctgggcgaacagggttcctggtatgccgacatcgaacaatccttcggg
atgccggcgttccccgtacaggcggtcgatacaaccggtgcaggggacgcctttaccggt
ggccttgcggcggcgattgcaatgggacatccgattcgtagtgcgatttgccgggccatg
gcggtcgcggcgatctcggtcacgcgccacggcgcacagatcgcgatgccatcggctcgc
gaagtcgacgactttttgcaacccatcatgtcactggagtcgtaa

DBGET integrated database retrieval system