KEGG   Burkholderia phymatum: Bphy_7498Help
Entry
Bphy_7498         CDS       T00704                                 

Definition
pyridoxal-5'-phosphate-dependent protein beta subunit
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bph  Burkholderia phymatum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bphy_7498
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bphy_7498
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bphy_7498
Enzymes [BR:bph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bphy_7498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBPHY02:complement(271913..273100)
Genome map
AA seq 395 aa AA seqDB search
MLSKLNPNVAAMKCLQCGQLYPLNDYFEGCPLCLQSGTPASVVPHFADFPTELHHGNFGE
WMSYGCPSGLGEGNTPLSSLPRLAATLGIEALYAKNEFANPTGSHKDRMSAIVAQRALDI
RAKTIAVASSGNAGVSMAAYAARAGIDCVVVTTPDMSQNWRRAIEMHGARIIAMESSDDR
WVLIARHARRGDWYPATNYLMPPVGSNPFGVDGYRAIALELYLQFPAVPPTDILVPTARG
DLLWGIAKGYQDLRNTGLISVTPRVHAVEPFPRIGRAREGHGMVCSNFSGDTAMVSIGGN
TVTFQSLLALELTDASGVAVNDQEASHDRLLLAKEGLYVELSSAAAVSGLRKLVAQGKIG
ARSRVVMIATSHGYKEQSEPEFSGQLISTPLMHEG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagcaaactcaatccgaatgtagcagccatgaaatgcctacaatgtggtcagctt
tacccgctgaacgactatttcgaaggctgtcctttatgcctgcaatctggcacgccagcg
agcgtcgtgccccatttcgctgatttcccgacagagttgcatcatggtaattttggggag
tggatgtcatatggatgtccgtctggtctgggcgaaggcaacacaccgttgtccagtctc
ccacggctcgcggcgactctaggcatagaagcgctgtacgccaagaatgagttcgccaac
cccactggctcacacaaggacagaatgagcgcgatagtggcccaacgcgcactcgatatt
cgtgccaagacgattgccgttgcctcgagcggaaatgccggggtctcaatggcagcctat
gcagcccgcgccggcatcgattgcgttgtcgtaacgacgccggacatgagccagaactgg
cgtcgggcaatcgaaatgcatggcgcgcggatcatcgcgatggaaagttcggacgatcga
tgggtgctaattgcacggcacgcgaggcgtggcgactggtatccggccaccaactacctt
atgccgcccgttggcagcaaccccttcggcgtggatggctacagggctatcgcactcgag
ctgtacctgcagtttccggcggtcccacccacagacatactcgtgcccaccgcccgcggt
gatctcctgtggggtatcgcgaaaggctatcaggacttgcggaatactggtttgataagc
gtaaccccgagggttcacgctgtcgagccgttcccccgtatcggtcgtgcgagggaagga
cacggcatggtatgcagcaacttctccggcgacacagccatggtgtcaatcggagggaac
accgtcaccttccagtcattgcttgcactcgagctgacagatgcctccggagtggcggtc
aatgatcaggaagccagccatgaccgacttctccttgcaaaggaagggctctacgttgag
ctttcgagtgccgccgccgtgtcggggctgcgtaaattagttgctcagggaaagattgga
gctcgttcgcgcgtcgtcatgattgctacgtcgcacggttataaggaacaatccgagcct
gaattcagcggacaactgatatcgacaccattgatgcacgaagggtga

DBGET integrated database retrieval system