KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_005Help
Entry
BPLAN_005         CDS       T00996                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPLAN_005 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPLAN_005 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BPLAN_005 (sucB)
Enzymes [BR:bpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BPLAN_005 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6219..7418)
Genome map
AA seq 399 aa AA seqDB search
MAEYNLTLPAMGESIAEATIIRWLKNEGDSIKKEDILVEIATDKVDSEISSPVNGILKKK
LFSANEVAKVGSSIAILETEETFKIFPEEDVYAVSPCKRFYSPLVRTIAYKEEISSSELD
TIEGTGYKNRVTKKDILKYLHLKKKTRIISPNYAFLSSYNSQNHEEIVEMDRMRKITASH
MIESKNISAHVTSFVEADVTNIVKWRDKIKDSFQKNTGEKLTLMSVFVECVVKAIKDLPM
INISVNGTNIIKKRNIHIGLATALPNGNLIVPVIKDADSYSLGGLIKIINDLIKRARSNQ
LKPEETQGGTYTISNIGSFGNLFGTPIIHQPQVAIMAIGLIQKKLSVIETPEGDFIGIRH
KIYLSHSYDHRVIDGVLGGGFAKKVALYLEKFNCYTKII
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtataatttgacccttccagccatgggggaaagtatagctgaggctactatc
attcgttggttaaaaaacgaaggagattctataaaaaaagaagatattttagtggagatt
gctacggataaggtagattctgaaatttcttctcctgtaaatggaatattgaaaaaaaaa
ttgttttctgcaaatgaagtggctaaggtaggaagttctatagctattttagaaacagaa
gaaacattcaaaatatttcctgaagaggatgtttatgcagtatctccatgtaaacgtttc
tattctcctcttgtacgtactattgcttataaagaagaaattagttcatctgaattagat
actatagaaggtaccggatataaaaatcgtgtaaccaaaaaggacattctgaaatatctt
catttaaagaaaaaaactagaatcatatctcctaattatgcatttttatcctcctataac
agtcagaatcatgaggaaatcgtagaaatggatagaatgcgtaagattacggcttctcat
atgattgaaagtaaaaacatatctgcacatgtgacttcatttgtggaagcagatgtgaca
aatattgtcaaatggagagataaaataaaagattctttccagaagaatacaggagaaaaa
ttaaccttaatgtccgtttttgtagaatgtgtagttaaagctataaaagatcttccaatg
atcaacatttctgttaatggaactaatattataaaaaagagaaatattcatataggatta
gctaccgcattacctaatgggaatttgattgttcctgtgattaaagatgcagattcctat
agtttaggaggattaataaaaattattaatgatttaatcaaaagagctagatctaatcaa
ttaaaacctgaagaaactcaaggaggaacttatacaatcagtaatattggaagctttgga
aatctatttggaactcctattatacatcaaccacaagtggctattatggcaataggttta
atccaaaaaaaattatctgtaatagaaactccagagggagattttattgggataagacat
aaaatttatttatctcattcttatgatcatagagtaatcgatggagttttgggaggaggt
tttgctaaaaaagtagccttatatttagaaaaatttaattgttatacaaaaataatatga

DBGET integrated database retrieval system