KEGG   Blattabacterium sp. (Periplaneta americana): BPLAN_016Help
Entry
BPLAN_016         CDS       T00996                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bpi  Blattabacterium sp. (Periplaneta americana)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPLAN_016 (folK)
Enzymes [BR:bpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BPLAN_016 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(19976..20536)
Genome map
AA seq 186 aa AA seqDB search
MQFFSILLKKIFFLKEHDIFLLQGSNKNNKKNYLEESLVLISKEIGKVIKKSSYFESEAW
NMNKNTSTFYNRALHIKTLYSPMEILEKISHIELKFGRKSKSITDKNDSSEKRKYKDREI
DIDILFYDHLIMHSSILTIPHPLFHFRRFALEPMCEISPRKYHPVFHITLLEILGLCADK
FKTRRI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttttcagtatattactaaaaaaaattttttttttgaaagaacatgatattttc
ttattacaaggaagcaataagaataataaaaaaaattatttagaagaatctttagtctta
atttctaaagaaataggaaaagtaattaaaaaatcctcttattttgaaagtgaagcttgg
aatatgaacaaaaatacatccactttttataatagggctttacatataaaaactttgtat
tctcccatggagattttggaaaaaatctctcatattgaattgaaattcggaagaaaatct
aaatctattacggataaaaatgattcttctgaaaaaagaaagtacaaggatagagaaata
gatatagatattttgttttacgatcatcttataatgcacagttctattttaactattcca
catcctttattccattttcgtagattcgctctagaacctatgtgtgaaatatcacctaga
aaatatcatcccgtatttcatattactctattagagatattaggtttgtgtgcagataaa
tttaaaacaagaagaatataa

DBGET integrated database retrieval system