KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_045Help
Entry
BPLAN_045         CDS       T00996                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, dihydrolipoamide succinyltransferase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
bpi00020  Citrate cycle (TCA cycle)
bpi00310  Lysine degradation
bpi01100  Metabolic pathways
bpi01110  Biosynthesis of secondary metabolites
bpi01120  Microbial metabolism in diverse environments
bpi01130  Biosynthesis of antibiotics
bpi01200  Carbon metabolism
Module
bpi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPLAN_045 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BPLAN_045 (sucB)
Enzymes [BR:bpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BPLAN_045 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding QRPTase_N RnfC_N
Motif
Other DBs
NCBI-ProteinID: ACX83681
UniProt: D0J8L0
Position
57142..58368
Genome map
AA seq 408 aa AA seqDB search
MIIKVKVPSPGESITEVEIASWFVKDGDYVFKNQVIAEIDSDKATLEISAEENGAISLMV
EKGKRIQVGDVLCIIDTSKKKPNENYKNLDFHEEKIQKKQDIIKKIPSPASKKILSEKNI
STEFIHGTGKQGRITKKDCILAESSTTTDSSLSPLIEKGFPTYRSREKKITPLSSLRRKL
SERLVSVKNQTAMLTTFNEVDMQEIFIIRKKYKNIFKEKHGVNLGFMSFFTLSCVRALKL
YPDVNAMISGSEKINFEYYDISIAISGPKGLMVPVIRNAEDLSFRGIEKEIHRLSTSVRN
GKITINEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGIHKVVERPVVINGSIEIRPVM
YLALSYDHRIIDGRESVGFLVSVKEAIENPIKFLMEGSENNIERVLEL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgataatcaaagtaaaggtcccttctccaggagaatctattacagaggtagagatcgcc
tcatggtttgtcaaagatggagattacgtatttaaaaatcaagtaatagctgaaatagat
tcagataaggctactttagaaatttctgcggaagaaaatggggcgatttccttaatggta
gaaaaaggaaaaagaatacaagttggggatgttctatgtattatagacacttctaaaaaa
aaacccaatgaaaattataaaaatttagattttcatgaagaaaaaatccaaaaaaaacag
gatataataaaaaaaattccttctccagcatcaaaaaaaatattgtcagaaaaaaatatt
tccacagaatttattcacggaactggaaaacagggaagaattacaaaaaaagattgtatt
cttgctgaatcttctactactactgatagttctttatctcctctcatagaaaaaggtttc
cctacttacaggtctcgtgaaaaaaaaatcactcctctttcttctttaagaagaaaacta
tctgaaagattggtatctgtaaaaaatcaaacggccatgctgaccacttttaatgaggtg
gatatgcaggaaatttttattataaggaaaaaatataaaaatatttttaaggaaaaacat
ggagttaatttaggtttcatgtctttttttactctctcttgtgtgagagcattaaaatta
tatccagatgttaatgctatgattagtggatcagaaaagattaattttgaatattatgat
attagtattgctatatctggacctaaaggactaatggtccctgttattagaaatgctgaa
gatctatcctttcgtggaatagaaaaggaaattcatagattatctacaagtgttcgtaat
ggaaaaattactataaatgaaatgacgggtggaacttttactattactaatggcggagta
tttgggtctatgctttctactccaataataaacccgccacaaagtgctattttaggaatt
cataaagtagtagaaagacctgtggttattaatgggtcaatagaaatacgtcctgtaatg
tatttggctttatcttatgatcatagaatcattgatggaagagaatctgttggattttta
gtttctgtaaaagaagcaatagaaaatccaataaaatttttaatggaaggaagtgaaaat
aacattgagagagtattagaattataa

DBGET integrated database retrieval system