KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_049Help
Entry
BPLAN_049         CDS       T00996                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
bpi00020  Citrate cycle (TCA cycle)
bpi00640  Propanoate metabolism
bpi00660  C5-Branched dibasic acid metabolism
bpi01100  Metabolic pathways
bpi01110  Biosynthesis of secondary metabolites
bpi01120  Microbial metabolism in diverse environments
bpi01130  Biosynthesis of antibiotics
bpi01200  Carbon metabolism
Module
bpi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPLAN_049 (sucC)
   00640 Propanoate metabolism
    BPLAN_049 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BPLAN_049 (sucC)
Enzymes [BR:bpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BPLAN_049 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ACX83684
UniProt: D0J8L3
Position
60390..61619
Genome map
AA seq 409 aa AA seqDB search
MNLHEFQGKEILRSFSVKIPDGVLVTTPEEAVQAAKMIFKKTNKNSLVIKAQIHAGGRGK
GGGIQIAKSLEEVYEKSKNLLGKYLITPQTSKKGKLVRKVLISDDVYSTPNRMGEIMKNS
FFSPKEYYLSILVNRDIEKNVILYSKEGGIDIEDISKKRPDKIFLEEIDPFLGLQLFQVR
KIGYNLGLNEEVLKDFRNFLISLYNAYLSCDALLLEINPLIRTFDHQIVAVDTKMVLDDN
ALFRQKKYASFRDQKEEDPVEIEAFEAKLNFLKLEGNVGCMVNGAGLAMATMDMIKSCGG
NPSNFLDIGGSADKERVEKAFQIILKDPSVKAIFINIFGGIVRCDTVAEGIINSYHNIDH
KIKIPVIVRLQGTNEMVAKKRLENSQLPIYYTSTLKEAADRIKKILMTR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaattccaaggaaaggaaatattaagatctttttctgttaagatccct
gatggagttttggttactactccagaagaggcagttcaggctgcaaaaatgattttcaaa
aaaactaataaaaattctttagtcattaaagcacaaatacatgcaggtggtcgtggaaaa
ggaggaggaatacaaatagccaaatctttggaagaagtatatgaaaaatcaaaaaacctt
ttaggaaagtatttgattactccacaaacttctaaaaaaggaaaattagttcgaaaagta
ctcatttccgatgatgtctattctactcctaataggatgggagagataatgaaaaattct
tttttttctcctaaagaatattatttatcgatattagtaaatcgtgatatagaaaaaaat
gtcattctctattctaaagaaggaggaatagatatagaagatatatctaagaaacgtcca
gataaaatctttctagaagaaatagatccatttttgggtttgcagttatttcaagttaga
aagattggatataatttaggattaaatgaagaagttctaaaagatttcagaaatttttta
atttctctatacaatgcttatttgtcttgtgatgccttattattggaaattaatccttta
attcgaacttttgatcatcaaattgtggcagtagacacaaaaatggttttggatgataat
gcgttgtttcgtcaaaaaaaatatgctagttttcgtgatcaaaaagaagaagatcctgtt
gaaatagaagcttttgaagcaaaattaaattttttaaaattagaaggaaatgtaggatgt
atggtaaatggagctggattagctatggctaccatggatatgattaaatcttgtggagga
aatccgtctaattttttagacatagggggatctgctgataaagagcgtgttgaaaaagcg
tttcaaattatcttgaaagatccatctgtaaaggctatattcataaatatttttggagga
attgttcgttgtgatacagttgcagaaggaattattaactcatatcataacattgatcat
aaaattaaaataccggtaattgttcgtttacaaggaaccaatgaaatggtcgcaaaaaaa
agacttgaaaatagtcaattgcctatttattacacatccactttaaaagaggcagctgat
agaataaaaaaaattttaatgactagataa

DBGET integrated database retrieval system