KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_070Help
Entry
BPLAN_070         CDS       T00996                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPLAN_070 (folE)
Enzymes [BR:bpi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BPLAN_070 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84568..85242
Genome map
AA seq 224 aa AA seqDB search
MMGEEYKKFLEKDNKDTNFLENHETPLRDDAFLISDEKKIDKIEKHFFHIMEILGLDMND
DSLRSTPKRVAKMFIKEIFSGLNPKNHPHLSTFENKYKYNQMLIEKNIIVYSTCEHHFLP
IVGKAHVGYISNGKVVGLSKINRIVNFYAKRPQVQERLTMQIVKSLQKILDTKDVACIID
AKHLCVNSRGIRDIDTRTITTELVGAFKKDSEIRREFFHYIGRS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatgggagaagagtataaaaaatttttagaaaaagataataaggatactaatttttta
gaaaatcatgaaactccactacgtgatgatgcttttcttataagcgatgaaaaaaaaatt
gataaaatagaaaaacattttttccacattatggaaattttaggtttggatatgaatgat
gatagtttacgcagtacacctaaacgtgtagcaaaaatgtttataaaagaaatatttagc
ggactaaatccaaaaaatcatcctcatttatccacttttgaaaataaatataaatataat
cagatgttgatagaaaaaaacataatagtttattctacttgtgagcatcattttctacct
attgttggaaaagcacatgttggctacatttccaatggaaaggttgtgggtctttctaaa
attaatagaatcgtaaatttttacgcaaaaagaccacaagttcaagaacgtttaactatg
caaattgttaaatctttacaaaaaatactagatacaaaagatgttgcttgcattatagac
gcaaaacatttatgtgtaaattctcgtggaattcgagatatagacaccagaacgatcact
actgaattagtaggagcatttaaaaaagattcggaaattcgaagagaatttttccattat
attggaagatcctaa

DBGET integrated database retrieval system