KEGG   Blattabacterium sp. (Periplaneta americana): BPLAN_070Help
Entry
BPLAN_070         CDS       T00996                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bpi  Blattabacterium sp. (Periplaneta americana)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84568..85242
Genome map
AA seq 224 aa AA seqDB search
MMGEEYKKFLEKDNKDTNFLENHETPLRDDAFLISDEKKIDKIEKHFFHIMEILGLDMND
DSLRSTPKRVAKMFIKEIFSGLNPKNHPHLSTFENKYKYNQMLIEKNIIVYSTCEHHFLP
IVGKAHVGYISNGKVVGLSKINRIVNFYAKRPQVQERLTMQIVKSLQKILDTKDVACIID
AKHLCVNSRGIRDIDTRTITTELVGAFKKDSEIRREFFHYIGRS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatgggagaagagtataaaaaatttttagaaaaagataataaggatactaatttttta
gaaaatcatgaaactccactacgtgatgatgcttttcttataagcgatgaaaaaaaaatt
gataaaatagaaaaacattttttccacattatggaaattttaggtttggatatgaatgat
gatagtttacgcagtacacctaaacgtgtagcaaaaatgtttataaaagaaatatttagc
ggactaaatccaaaaaatcatcctcatttatccacttttgaaaataaatataaatataat
cagatgttgatagaaaaaaacataatagtttattctacttgtgagcatcattttctacct
attgttggaaaagcacatgttggctacatttccaatggaaaggttgtgggtctttctaaa
attaatagaatcgtaaatttttacgcaaaaagaccacaagttcaagaacgtttaactatg
caaattgttaaatctttacaaaaaatactagatacaaaagatgttgcttgcattatagac
gcaaaacatttatgtgtaaattctcgtggaattcgagatatagacaccagaacgatcact
actgaattagtaggagcatttaaaaaagattcggaaattcgaagagaatttttccattat
attggaagatcctaa

DBGET integrated database retrieval system