KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_191Help
Entry
BPLAN_191         CDS       T00996                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPLAN_191 (folA)
   00670 One carbon pool by folate
    BPLAN_191 (folA)
Enzymes [BR:bpi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BPLAN_191 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210830..211351
Genome map
AA seq 173 aa AA seqDB search
MKIILISAVSSNGVIGKNNQLMWHLPNDLKRFKNMTFGETVLMGRKTFESIGKILPGRRN
IILTKKNKIHFFSSTNTNNKTNPRGTFEVYSSLKQIYDLNYKKIFVIGGEKIYTSTIDKA
HIIELTVIHKKFYGDAKFPKIPLSKWKKTYEFFHEKDKHHLYNYSFIRYERKD
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatactgatttctgctgtttctagtaatggggttataggaaaaaataatcaa
ttaatgtggcatttacctaatgatttaaaacgtttcaaaaatatgacttttggagaaacc
gttcttatgggtcggaaaacttttgaatccattgggaaaattcttccaggaagaagaaat
attatactaacaaaaaaaaataaaatacatttcttttcctcgactaatactaataataag
actaatcctcgcggaacctttgaagtttattcttctttgaaacagatttatgacttaaat
tataaaaaaatatttgtgataggaggagagaaaatatatacttctactatagataaagct
catatcatagaattaactgtaattcacaaaaaattttacggagatgcaaaatttccaaaa
attcctcttagcaagtggaaaaaaacatatgaattttttcatgaaaaagataaacatcat
ttatataattacagttttatacgatatgaaagaaaagactaa

DBGET integrated database retrieval system