KEGG   Blattabacterium sp. (Periplaneta americana): BPLAN_191Help
Entry
BPLAN_191         CDS       T00996                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bpi  Blattabacterium sp. (Periplaneta americana)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bpi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210830..211351
Genome map
AA seq 173 aa AA seqDB search
MKIILISAVSSNGVIGKNNQLMWHLPNDLKRFKNMTFGETVLMGRKTFESIGKILPGRRN
IILTKKNKIHFFSSTNTNNKTNPRGTFEVYSSLKQIYDLNYKKIFVIGGEKIYTSTIDKA
HIIELTVIHKKFYGDAKFPKIPLSKWKKTYEFFHEKDKHHLYNYSFIRYERKD
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatactgatttctgctgtttctagtaatggggttataggaaaaaataatcaa
ttaatgtggcatttacctaatgatttaaaacgtttcaaaaatatgacttttggagaaacc
gttcttatgggtcggaaaacttttgaatccattgggaaaattcttccaggaagaagaaat
attatactaacaaaaaaaaataaaatacatttcttttcctcgactaatactaataataag
actaatcctcgcggaacctttgaagtttattcttctttgaaacagatttatgacttaaat
tataaaaaaatatttgtgataggaggagagaaaatatatacttctactatagataaagct
catatcatagaattaactgtaattcacaaaaaattttacggagatgcaaaatttccaaaa
attcctcttagcaagtggaaaaaaacatatgaattttttcatgaaaaagataaacatcat
ttatataattacagttttatacgatatgaaagaaaagactaa

DBGET integrated database retrieval system