KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_206Help
Entry
BPLAN_206         CDS       T00996                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
bpi00340  Histidine metabolism
bpi01100  Metabolic pathways
bpi01110  Biosynthesis of secondary metabolites
bpi01230  Biosynthesis of amino acids
Module
bpi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BPLAN_206 (hisD)
Enzymes [BR:bpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BPLAN_206 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACX83835
UniProt: D0J914
Position
complement(223497..224792)
Genome map
AA seq 431 aa AA seqDB search
MDIQVYIYPPFKTWKSIIKRSVQDVSRLSGFVLPIINNVKLYGDIALKSYTKKYDHVNLK
HIQISEEEINESSKNISDCLKKSIEVAHKNIQSFHKPQIQKESKIEVSPGVICWRKSVPI
EKVGLYIPGGSAPLLSTVLMLGVPSNLAGCEDIILCSPPNKNGKIHPSILYTATKYIGIK
RIYKIGGAQAIAAMAYGTESVSSVYKIFGPGNSYVTLAKQIVAQKGIVSIDMPAGPSEVV
ILADETANPEYVASDLISQSEHDPESYILLITISISWMEKIKKELKKQLTSFSTRQNIMK
KSLERSKMIVLSSLEESIHLINQVAPEHLIINCHNASYWGDKIKNAGSVFLGNYSPVSVG
DYASGTNHVLPTYGYAKSYSGVSVDSFLKKITFQKITKKGLRGLSKCVGGLSLTEGLIAH
KKSIDIRLKNE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggacatacaagtgtatatatatcctccatttaaaacatggaaatctattataaaaaga
tctgtacaagatgtttctagattaagtggttttgttttgcctattataaataatgtgaaa
ctatacggtgatatagctttaaaaagctatacaaaaaaatatgatcatgtgaatttaaaa
catattcaaatttcggaagaagaaataaatgaatccagtaaaaacatttcagattgtttg
aaaaaatctattgaagtagcacataaaaacatccaatcttttcataaaccacaaatacag
aaagaatcaaaaatagaagtctctccaggagttatttgttggagaaaatctgttcctata
gaaaaggtcggtttatatatccctggaggttctgcccctttattatctactgtattaatg
ttaggagttcctagtaatttagctggttgcgaagatattattttgtgctctcctccaaat
aaaaatggaaaaatacatccatccattttatatacagctactaagtatataggaataaaa
cgaatctataaaataggaggagctcaagctattgccgctatggcttatggaactgaaagt
gtttcttctgtttacaaaatatttggtccaggaaattcttatgttacactagctaaacaa
attgtagcacaaaaaggaatagtctctatagatatgccagctggaccttcagaagtcgtt
attttagcagatgaaacagcgaatccagaatatgttgcttctgatttaatttctcaatca
gaacatgatccagaaagttacattcttttaattaccataagtatatcctggatggaaaaa
ataaaaaaagaattaaaaaaacaattaactagtttttccactagacaaaatattatgaaa
aaatctttggaaaggagcaaaatgattgttctttcttctttggaagaaagcattcatttg
atcaatcaagtggctccagaacatttaatcattaattgtcataatgcttcttattggggg
gataaaataaaaaatgctggatctgtatttctgggaaattattctccagtcagtgtggga
gattatgcttctggaacaaatcatgtgcttcctacttatgggtatgcaaaatcttatagt
ggagtatctgtagatagttttctaaaaaaaataacttttcaaaaaattaccaaaaaagga
ttacgaggtttatcaaaatgtgttggtggactatctttaacagaaggtttaatagcacat
aaaaaatccattgatattcgattgaaaaatgaatga

DBGET integrated database retrieval system