KEGG   Blattabacterium sp. (Periplaneta americana): BPLAN_214Help
Entry
BPLAN_214         CDS       T00996                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpi  Blattabacterium sp. (Periplaneta americana)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPLAN_214 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPLAN_214 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPLAN_214 (trpA)
Enzymes [BR:bpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPLAN_214 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(230402..231172)
Genome map
AA seq 256 aa AA seqDB search
MNKLHKFFELKKKNILCIYFTAGYPTISSTEKIITTLQDLPVDLIEIGIPYSDPLADGIV
IQNSNKISLKNGMNISLLFSQIKKIKDSIRTPIILMGYYNQFYQFGEEKFLKESNEAGVS
GLIFPDLPVNVFVEKYQKMFKKHLLSMIFLITPKTDPDRISLLNEITDGFLYLISSNSVT
GRPIPFGEKQISYFKRIQKLSTHVPKLIGFGIRDKKTFEISCQYANGGIIGSSFIQSLNK
NRLESSIREYIKSILG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactacataaattttttgaattaaaaaagaaaaatatattgtgcatttatttc
acagcaggttatccaaccataagcagtacagaaaaaataataaccactttacaggatctt
cctgtagatttaattgaaatagggattccttattcggatcctttagcagatggaatagtc
attcaaaatagtaataaaatttcgttaaaaaatggaatgaatatttctttgttattttca
caaataaaaaagattaaagattctataagaacccctattattcttatggggtattacaat
cagttttatcaatttggagaagaaaagtttttaaaagaaagtaatgaagccggggtatct
ggactaatttttccagatttgcctgtcaatgtttttgtagaaaaatatcaaaaaatgttt
aaaaaacatttgttatctatgatcttcttgattacaccaaaaacagatccagatagaatt
tccttattaaatgaaataaccgatggttttttatatttaatttcttctaattctgtaact
ggaaggcctattccttttggagaaaagcaaatttcctattttaagagaatacaaaaactt
tctacacatgtacctaaattaattggatttggaataagagataaaaaaacctttgaaatt
tcatgtcaatatgcaaatggaggaataataggaagttctttcattcaatcattaaataaa
aatagattagaatctagtattcgagaatatataaaatctattttagggtag

DBGET integrated database retrieval system