KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_214Help
Entry
BPLAN_214         CDS       T00996                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
bpi00260  Glycine, serine and threonine metabolism
bpi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpi01100  Metabolic pathways
bpi01110  Biosynthesis of secondary metabolites
bpi01130  Biosynthesis of antibiotics
bpi01230  Biosynthesis of amino acids
Module
bpi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPLAN_214 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPLAN_214 (trpA)
Enzymes [BR:bpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPLAN_214 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACX83842
UniProt: D0J921
Position
complement(230402..231172)
Genome map
AA seq 256 aa AA seqDB search
MNKLHKFFELKKKNILCIYFTAGYPTISSTEKIITTLQDLPVDLIEIGIPYSDPLADGIV
IQNSNKISLKNGMNISLLFSQIKKIKDSIRTPIILMGYYNQFYQFGEEKFLKESNEAGVS
GLIFPDLPVNVFVEKYQKMFKKHLLSMIFLITPKTDPDRISLLNEITDGFLYLISSNSVT
GRPIPFGEKQISYFKRIQKLSTHVPKLIGFGIRDKKTFEISCQYANGGIIGSSFIQSLNK
NRLESSIREYIKSILG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactacataaattttttgaattaaaaaagaaaaatatattgtgcatttatttc
acagcaggttatccaaccataagcagtacagaaaaaataataaccactttacaggatctt
cctgtagatttaattgaaatagggattccttattcggatcctttagcagatggaatagtc
attcaaaatagtaataaaatttcgttaaaaaatggaatgaatatttctttgttattttca
caaataaaaaagattaaagattctataagaacccctattattcttatggggtattacaat
cagttttatcaatttggagaagaaaagtttttaaaagaaagtaatgaagccggggtatct
ggactaatttttccagatttgcctgtcaatgtttttgtagaaaaatatcaaaaaatgttt
aaaaaacatttgttatctatgatcttcttgattacaccaaaaacagatccagatagaatt
tccttattaaatgaaataaccgatggttttttatatttaatttcttctaattctgtaact
ggaaggcctattccttttggagaaaagcaaatttcctattttaagagaatacaaaaactt
tctacacatgtacctaaattaattggatttggaataagagataaaaaaacctttgaaatt
tcatgtcaatatgcaaatggaggaataataggaagttctttcattcaatcattaaataaa
aatagattagaatctagtattcgagaatatataaaatctattttagggtag

DBGET integrated database retrieval system