KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_215Help
Entry
BPLAN_215         CDS       T00996                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
bpi00260  Glycine, serine and threonine metabolism
bpi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpi01100  Metabolic pathways
bpi01110  Biosynthesis of secondary metabolites
bpi01130  Biosynthesis of antibiotics
bpi01230  Biosynthesis of amino acids
Module
bpi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPLAN_215 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPLAN_215 (trpB)
Enzymes [BR:bpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPLAN_215 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACX83843
UniProt: D0J922
Position
complement(231156..232358)
Genome map
AA seq 400 aa AA seqDB search
MKYLADKNGYYDSFGGAFIPEMLQRQIIELQTHYQKIIKSLEFQKSFKNILKNYVGRPTP
LFFSKKYSDKYGGKIYLKREDLNHTGSHKINNTVGQSLLAKILGKKKIIAETGAGQHGVA
TATTCALMNLECMIFIGEKDMERQSSNVLRMKALGAKVIPVLSGDKTLKDAVNEAIRFWI
NHSECYYLIGSTIGPHPYPQMVADFQSIISEEIKKQLEEKEGCKFPNYIVACIGGGSNAA
GSFYHFLDHDFVNLIAVEAAGLGVHTKKTAASIHCGTKGVLHGSMTFLLQNKDGQVLPTY
SISAGLDYPGIGPMHANLFLKKRVNFLHATDEEALQAGYELIRLEGIIPALESAHALAAL
KKIPSKINDVIIVNLSGRGDKDINVYNKFFDKYSKYEQTT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttagccgataaaaatggatattacgactcatttggaggagcttttattcct
gaaatgttacagagacaaataattgaattacaaactcattatcaaaaaattattaaaagt
ttagaatttcaaaaatcatttaaaaatatattaaagaattacgtaggaagacctactcct
ttattttttagtaaaaaatattccgataaatatggaggtaaaatttatcttaaaagagaa
gatttaaatcatacgggatcccataaaattaacaatacggtaggtcaaagcttattagct
aagatattagggaaaaaaaaaattattgctgaaacaggtgcaggacaacatggagtagca
acagctactacttgtgctttaatgaatttagaatgtatgatttttattggcgagaaagat
atggaacgtcaatcttctaatgtattacgaatgaaggctcttggagctaaagttattcca
gttcttagtggagataaaacacttaaagatgcagtcaatgaagctattcgtttttggatc
aaccattcagaatgttattatttaataggatccacaataggtcctcatccgtatcctcaa
atggttgccgattttcaatcgattataagcgaagaaataaagaaacaattagaagagaaa
gaaggatgtaaatttccaaattatattgtcgcttgtataggtggaggaagtaatgcagcg
ggatctttctatcattttttagatcatgattttgtaaatctcattgcagtggaagctgct
ggtttaggggtccatacaaaaaagacagctgcttctatacattgcggaactaaaggagtg
ttacatggaagtatgacctttcttttacagaataaagatggtcaggttcttcctacttat
tctatatcagctggtttagattatccaggaatagggcctatgcatgcaaatcttttttta
aaaaaacgtgtaaattttttacatgctacagatgaagaagctttgcaagcaggatatgaa
ttgatccgattagaaggaattattcctgcattggaaagtgctcatgcattagctgcatta
aaaaaaatcccgtctaaaataaacgatgttattattgttaatttatcgggaagaggagat
aaggatattaatgtctataataaattttttgataagtattctaaatatgaacaaactaca
taa

DBGET integrated database retrieval system