KEGG   Blattabacterium sp. (Periplaneta americana): BPLAN_215Help
Entry
BPLAN_215         CDS       T00996                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpi  Blattabacterium sp. (Periplaneta americana)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPLAN_215 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPLAN_215 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPLAN_215 (trpB)
Enzymes [BR:bpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPLAN_215 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(231156..232358)
Genome map
AA seq 400 aa AA seqDB search
MKYLADKNGYYDSFGGAFIPEMLQRQIIELQTHYQKIIKSLEFQKSFKNILKNYVGRPTP
LFFSKKYSDKYGGKIYLKREDLNHTGSHKINNTVGQSLLAKILGKKKIIAETGAGQHGVA
TATTCALMNLECMIFIGEKDMERQSSNVLRMKALGAKVIPVLSGDKTLKDAVNEAIRFWI
NHSECYYLIGSTIGPHPYPQMVADFQSIISEEIKKQLEEKEGCKFPNYIVACIGGGSNAA
GSFYHFLDHDFVNLIAVEAAGLGVHTKKTAASIHCGTKGVLHGSMTFLLQNKDGQVLPTY
SISAGLDYPGIGPMHANLFLKKRVNFLHATDEEALQAGYELIRLEGIIPALESAHALAAL
KKIPSKINDVIIVNLSGRGDKDINVYNKFFDKYSKYEQTT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttagccgataaaaatggatattacgactcatttggaggagcttttattcct
gaaatgttacagagacaaataattgaattacaaactcattatcaaaaaattattaaaagt
ttagaatttcaaaaatcatttaaaaatatattaaagaattacgtaggaagacctactcct
ttattttttagtaaaaaatattccgataaatatggaggtaaaatttatcttaaaagagaa
gatttaaatcatacgggatcccataaaattaacaatacggtaggtcaaagcttattagct
aagatattagggaaaaaaaaaattattgctgaaacaggtgcaggacaacatggagtagca
acagctactacttgtgctttaatgaatttagaatgtatgatttttattggcgagaaagat
atggaacgtcaatcttctaatgtattacgaatgaaggctcttggagctaaagttattcca
gttcttagtggagataaaacacttaaagatgcagtcaatgaagctattcgtttttggatc
aaccattcagaatgttattatttaataggatccacaataggtcctcatccgtatcctcaa
atggttgccgattttcaatcgattataagcgaagaaataaagaaacaattagaagagaaa
gaaggatgtaaatttccaaattatattgtcgcttgtataggtggaggaagtaatgcagcg
ggatctttctatcattttttagatcatgattttgtaaatctcattgcagtggaagctgct
ggtttaggggtccatacaaaaaagacagctgcttctatacattgcggaactaaaggagtg
ttacatggaagtatgacctttcttttacagaataaagatggtcaggttcttcctacttat
tctatatcagctggtttagattatccaggaatagggcctatgcatgcaaatcttttttta
aaaaaacgtgtaaattttttacatgctacagatgaagaagctttgcaagcaggatatgaa
ttgatccgattagaaggaattattcctgcattggaaagtgctcatgcattagctgcatta
aaaaaaatcccgtctaaaataaacgatgttattattgttaatttatcgggaagaggagat
aaggatattaatgtctataataaattttttgataagtattctaaatatgaacaaactaca
taa

DBGET integrated database retrieval system