KEGG   Blattabacterium sp. (Periplaneta americana): BPLAN_252Help
Entry
BPLAN_252         CDS       T00996                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bpi  Blattabacterium sp. (Periplaneta americana)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bpi00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bpi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
266979..268451
Genome map
AA seq 490 aa AA seqDB search
MKKILKYLLKKVHVLEIIGNPQKWIKGISICSQLVEIDTIFFAKKGKKTDGHQFITEAIQ
KGANTVVCEKKPVLLHKNITYVIVKNSMDALGTISSNFYDHPTKKIKLVGITGTNGKTSV
ATILHHLFYKMGEKSILISTMGIKILSQEFPTKHTTPSIVDINKYLNLSIQKGCKYAFME
VSSHGIHQKRIAGLLFTGGVLTNITHDHLDYHKSFENYLSTKKSFFENFLPKNAFALINS
DDPNSHEIIKNVLAKIYFYGLKKKTDYRIKIMKKNIHGNQLLIDGHKFFTFLIGEFNVSN
LLACYATAILLGKKKEEILQKINTIPPIKGRFEQFISYSGIRIIVDYAHNPDGIKNLLKA
IQEIKKQEERLICIIGCGGNRDKEKRSLMGKIVYETCDLSIFTSDNPREEDPEKILIDMK
NFRSYLNKDKEDILTIVNRKEAIRTAIQMAREKDIIVIAGKGHENYQEIQGKRYPFDDME
IAKTLFSEFS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatattaaaatatcttctaaaaaaagtacatgtattagaaattataggaaat
cctcaaaaatggataaaagggatttctatatgttctcaattggtagaaatagatacgata
ttttttgctaaaaaaggaaaaaaaacagatggacatcaatttattacggaggctatacaa
aaaggagctaacactgtagtttgtgaaaaaaaacctgttctccttcataaaaatatcacc
tatgtaattgtaaaaaattcgatggatgctttaggaactatttcttctaatttttatgat
catcctacaaaaaaaataaaattagtaggcattacaggaacgaatggaaaaacatctgta
gccaccatacttcaccatttattttataaaatgggagaaaaaagtattcttatttctacc
atggggattaaaattctatctcaggaatttcctaccaaacatactaccccaagtattgtt
gatattaataaatatttaaatttatcaatccaaaaaggatgtaaatatgcatttatggaa
gtgagttcacatggaattcatcaaaaaagaattgcagggttattatttacagggggggta
ttgactaatattacccatgatcatttagattatcataaatcttttgaaaattatctatca
actaaaaaatctttttttgaaaattttttgcctaaaaatgcttttgccttaattaattct
gatgatccaaattcacatgaaatcataaaaaatgttttggctaaaatttatttttatggg
ttgaaaaaaaaaacagattacaggataaaaattatgaaaaaaaatatccatggaaaccaa
ttgctaattgatggacacaaatttttcacctttttaattggagaatttaatgtttccaat
cttttggcttgctacgctacagctatattattggggaaaaaaaaagaggaaatcttgcaa
aaaataaatactattccacctataaaaggacgttttgaacaatttatatcctattcagga
attcggataattgtggattacgcccacaatccagatggaattaagaaccttttaaaagct
attcaggaaataaaaaaacaggaggaaagattaatttgcataataggttgtggaggaaat
agagataaagagaaacgttctttaatgggaaaaatagtttatgaaacatgtgatttatct
atttttacctcagataatcctagagaagaggatccagaaaaaatattaatagatatgaag
aattttagatcctatctaaataaagataaagaggatattttaactatcgttaacagaaaa
gaagctattcgaacagccattcaaatggctagagaaaaagatattattgtcatagcagga
aaaggacacgaaaattatcaagaaattcaaggaaaacgttatccttttgacgatatggaa
attgctaaaaccttattttctgaattttcttag

DBGET integrated database retrieval system