KEGG   Blattabacterium sp. (Periplaneta americana): BPLAN_273Help
Entry
BPLAN_273         CDS       T00996                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bpi  Blattabacterium sp. (Periplaneta americana)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bpi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(290653..291261)
Genome map
AA seq 202 aa AA seqDB search
MITHLRGKLIEKNQSSLIIDCNGVGYYLHISSYTYSSLLEEEGKEISIYTYLFIKENQHV
LYGFFERIERKIFSHLISVNGIGPSSAITILSSLTPHEIKESISREDIEVFNQVKGIGKK
TAQRIIIELKDKISISPSTIPKKGKNVNFFDKPPIFIKKEALSALIVLGFSPKESKKVLE
EILDKNPEFTVENLIKESLKKL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacacatttaagaggaaagctaatagaaaaaaatcaatcttctttaataatagat
tgtaatggagtcggatattaccttcatatatcttcgtatacctattcttctttattagaa
gaagaaggaaaagaaatttctatatatacttatctttttatcaaggaaaatcaacatgta
ttgtatggtttttttgaaagaatagaaagaaaaatattttctcatttgatatccgtaaat
gggataggtccaagttctgctataactatactatcttccttaacaccacatgaaataaaa
gaatctatatctagagaagatatagaagtattcaatcaggtgaagggaatcggaaaaaaa
actgctcagagaattatcatagaactgaaagataaaatttctattagtccttctactatt
cctaaaaaaggaaaaaacgttaactttttcgataagccccctattttcataaaaaaagaa
gctttaagcgctttgatcgtactaggtttttctcctaaagaatctaaaaaagttttagag
gagatcttggataaaaacccagaatttactgtagaaaatcttatcaaagaatctttaaaa
aaattgtaa

DBGET integrated database retrieval system