KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_350Help
Entry
BPLAN_350         CDS       T00996                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPLAN_350
Enzymes [BR:bpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BPLAN_350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374657..375439
Genome map
AA seq 260 aa AA seqDB search
MKINNILVSQAFTSSNSPYMELSKNENVKIDFRSFIEVKGASSSDVRKQKINFSDFTVVL
FISKKSIDHYFRLAESMRFKVPISMKYVCQTAAIAYYLQKYIVYRKRKIHIGKKSFQDIL
PYIKKHSKEKFLLPSSDILKPEIPKMLKKLNIFWKRAILYKTTSSDLSDLKNAYYDILVF
FSPACIKSLFENFPNFDQNNIKIATFGKNTLDAAYKAGLKIEIKVPTPKYPSMAKALEKY
IQEHRYKNYSTVTDLAKFLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaataatattctcgtttcacaagcatttacaagttcaaattctccctatatg
gagctcagcaaaaatgaaaatgtaaaaatagattttagatctttcatagaagtaaaagga
gcatcatcttctgatgtaagaaaacagaaaataaacttttctgattttactgtagttctt
tttataagtaaaaaatccatagatcattattttagattggcagaatcaatgcgtttcaaa
gttcctatttctatgaagtatgtttgtcaaacagcagccatagcctactacttacaaaaa
tatatagtgtacagaaaaagaaaaatacacattgggaaaaaatcctttcaagacattctt
ccttacattaaaaaacattcaaaagaaaaatttctcttaccctcttcagatatattaaaa
ccagaaatcccaaaaatgctgaaaaaactcaatattttttggaaaagagctattttatac
aaaactacttctagcgatttatctgatttgaaaaatgcttattatgatattttagttttc
tttagcccagcatgtataaaatctttatttgaaaactttcctaattttgatcaaaacaac
ataaaaatcgcaacctttggtaaaaacactttagatgcagcttacaaagccggattaaaa
atagaaataaaagttccaactccaaaatatccttccatggctaaagctttagaaaaatac
atacaggaacatcgttataaaaattattccactgtgacagatttagccaaatttcttggc
tga

DBGET integrated database retrieval system