KEGG   Blattabacterium sp. (Periplaneta americana): BPLAN_499Help
Entry
BPLAN_499         CDS       T00996                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bpi  Blattabacterium sp. (Periplaneta americana)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bpi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
514268..515575
Genome map
AA seq 435 aa AA seqDB search
MASFKIEGGSPLKGEIKPQGAKNEALQVLCAVLLTSEKLRIKNIPEIGDVKCLMQILQHL
GVVVKKNDIGDFTFQAKNICLEYLNTKKFREDGKCIRGSVMIAGPLLARFGKGCMPIPGG
DRIGRRRLDAHLRGFESLGSHIDYNRENQYFYLTSKYLKGKFILLEEASITATANIIMAA
SLAKGKTTIYNAACEPYIQQLCRLLNRMGAKIKGIGSNLIHVTGVTELGGCLHTILPDMV
EIGSWIGLAAITSSEIKIRNVSWKNLGIIPNIFQKMGISLEKKDDDIYIPSQKSYQIKKL
LNNAILTISDAPWPGLTPDLLSILTVVATQAKGSVLIHQKMFESRLFFVDKLIEMGAQII
LCDPHRATVIGLNHQSSLRGSLLNSPDIRAGISLLIAALSAQGTSRIKNIEQIDRGYENI
DQRLRLLGANIVRIK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttttaagatagaaggaggatctcctctaaaaggagaaataaaaccacaagga
gcaaaaaatgaagctttgcaagttttgtgtgcagtcttgctaacctcagagaaattgaga
ataaaaaatattccagaaataggagatgtaaaatgtttgatgcaaatacttcaacactta
ggagttgtagtaaaaaaaaatgatattggagattttacttttcaagctaaaaacatttgt
ctagaatatttaaatacgaaaaaatttcgtgaggatggaaaatgtattagaggctctgtc
atgattgcgggacctttgctagctagatttggaaaagggtgcatgcctatccccggagga
gatagaattggtcgtagacgtttagatgcacatctaagaggttttgaatctttaggaagt
catatagattataatagagaaaatcagtatttctatcttacctctaaatatttaaaagga
aaatttattcttctagaagaagcttctataacagctacagctaatattatcatggcggcg
tctttagctaaaggaaaaaccactatttataatgcggcttgtgaaccttatattcaacaa
ttatgtaggctattaaatagaatgggagcaaaaataaaaggcataggttctaatttaatc
catgttactggagttacagaattgggaggatgtctccatactattttgcctgatatggta
gaaataggaagttggataggattagcagctattactagttctgaaataaaaattcggaat
gttagttggaaaaacctaggaatcatcccgaatatattccaaaaaatgggaatatcctta
gaaaagaaagacgatgatatttatatcccatctcaaaaatcctaccagataaaaaaatta
ttaaataacgctatattaacaatttctgacgctccatggccaggtttaactccagattta
ctaagtattttaactgtggtagctactcaagcaaaaggaagtgtcttaatccatcaaaaa
atgttcgaaagtagattattttttgtagacaaattaattgaaatgggagcacaaataata
ttatgtgatcctcatagagcaaccgttattggtttgaatcatcaatcttctttacgaggt
tctctattaaactctccagatatccgagctggaatatctcttcttatagctgcactttct
gctcaaggaactagtaggataaagaatatagaacaaatagaccgaggatatgaaaatatt
gatcaaagattacgtcttttaggagcaaatattgtaagaataaaatga

DBGET integrated database retrieval system