KEGG   Blattabacterium sp. (Periplaneta americana): BPLAN_574Help
Entry
BPLAN_574         CDS       T00996                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpi  Blattabacterium sp. (Periplaneta americana)
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
597428..598297
Genome map
AA seq 289 aa AA seqDB search
MKKKTFAKIPLKYATLEKSQIVLIPVPYDYTGTWKKGSKKGPKAFLSASEHMELYDIETN
SEVYKRGIFLVKPVVNSSISSRRMVKIVYDITKKYLLKEKFVTLIGGEHSISIGSIRAFG
EKYTNMSILHMDAHADLRPIYNGDPYNHACSMHEASKKYPVIQIGIRSMDISEKSYIQNG
NIFYFHEIYQNDLWMKKAIQRLSENVFLSIDIDVFDPSIAPSTGTPEPGGLSWYKTLKFL
KMVFQKKKIIGFDIVELLPNERESSTDFLVVKLYYKLLSYKYELITYQS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaaacatttgcaaaaattcctctaaaatatgcaactcttgaaaaatctcaa
atagtacttattcctgttccatacgattatacagggacatggaaaaaaggatctaaaaaa
ggacctaaagcttttttatctgcatcagaacatatggaattatatgatatagaaactaat
tctgaagtatacaaaagaggaatttttcttgttaaacctgttgtaaattcttcaatttct
tccagaagaatggtaaaaatagtttacgatattactaaaaaatatcttttaaaagaaaaa
tttgttactctcattggtggagaacattccatttccataggaagtatcagagcttttgga
gaaaaatatacgaatatgagtattcttcatatggatgcacatgcagacttgcgtcctatc
tataatggagatccttataatcacgcatgttctatgcatgaagcctctaaaaaatatcct
gtaatccagataggaattcgaagtatggatatttcagaaaaatcgtacatccaaaatgga
aacattttttactttcatgaaatttatcaaaatgatttatggatgaaaaaagcgattcaa
agactatctgaaaatgtatttttaagcatagatatcgatgtttttgatccaagcatagcg
ccttctacaggaactccagaaccaggaggtttatcttggtacaaaactttaaaattttta
aaaatggtttttcaaaagaaaaaaattataggttttgatattgtggaacttttgccaaat
gaacgagaatcttctacagattttttagtcgttaaactttattataaactcttgtcatat
aaatatgaattaataacttatcaatcatga

DBGET integrated database retrieval system