KEGG   Brachyspira pilosicoli P43/6/78: BPP43_00720Help
Entry
BPP43_00720       CDS       T02387                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BPP43_00720
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BPP43_00720
Enzymes [BR:bpip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BPP43_00720
Two-component system [BR:bpip02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BPP43_00720
Bacterial motility proteins [BR:bpip02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BPP43_00720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150461..151594
Genome map
AA seq 377 aa AA seqDB search
MANKIKVLSIDDSALIRQLLTKIVNSDPDLEMVATAANPILAEAKLKTIKPDIITLDIEM
PEMDGITYLKKLMINNPIPVIMFSSLLDKHRELALDALNIGAFDYVIKPSANVRGGVEEL
ATDLVEKIKNAYNNRAKFYKKHGVAMPTETTTNITHNRVVVEAPKTSGFKVYPKNNADII
LPLVPSREVAMDKIILIGSSTGGTEALIECLKNVTPSAPPIVIAQHMPEHFTTSFARRLN
TVLKIEVFESEDGMSIGRGQAVLARGGKHTMIKVKNGKYYIEVVDGEPVTRHKPSVDVLF
RSGAVYAKNKAIGIILTGMGDDGANGMKEMKDAGAYNIAQNEETCTVFGMPREAIARGGV
DEILPLDRILAAALKKA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctaataaaattaaagttttatccattgatgatagtgcattgataagacaattgctt
acaaaaattgttaattctgaccctgatttggaaatggttgccactgctgctaaccctata
cttgcagaggctaaattaaaaactataaaacctgatattattactttagatatagaaatg
cctgaaatggacggtattacttatcttaaaaaacttatgattaataatcctattcctgta
ataatgtttagttctttgcttgataaacatagagaattagcattagatgctttaaatatt
ggtgcttttgattatgttattaagccttctgctaatgtaagaggcggtgttgaggaacta
gctacagatttagttgaaaagataaaaaacgcttataacaacagagctaagttttataaa
aagcatggtgttgctatgcctacagaaactactactaatattactcataatagagttgtg
gtagaagctcctaaaacttcaggatttaaagtttatccaaaaaataatgctgatattata
cttccgcttgtaccttctagagaagttgctatggataaaattatacttataggctcttct
acaggcggtactgaggctttgatagaatgtttaaaaaatgttacaccttctgctcctcct
atagtaatagctcagcacatgcctgaacattttactacttcttttgctaggagattgaat
actgtattaaaaatagaagtttttgaatctgaagatggtatgagtataggacgcggtcag
gcagtacttgcaagaggcggaaagcatactatgataaaagttaaaaatggaaagtattat
attgaagttgtagatggtgagcctgttactagacataaaccttctgtagatgtacttttt
agaagcggtgctgtatatgctaaaaataaagctataggtatcatacttactggaatgggt
gatgatggtgctaatggtatgaaagaaatgaaagatgccggtgcttataacattgctcaa
aacgaagagacttgtactgtttttggtatgccaagagaggctattgctagaggcggtgta
gatgagatacttccgcttgatagaatattagccgctgctcttaaaaaagcataa

DBGET integrated database retrieval system