KEGG   Brachyspira pilosicoli P43/6/78: BPP43_00720Help
Entry
BPP43_00720       CDS       T02387                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpip02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bpip02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150461..151594
Genome map
AA seq 377 aa AA seqDB search
MANKIKVLSIDDSALIRQLLTKIVNSDPDLEMVATAANPILAEAKLKTIKPDIITLDIEM
PEMDGITYLKKLMINNPIPVIMFSSLLDKHRELALDALNIGAFDYVIKPSANVRGGVEEL
ATDLVEKIKNAYNNRAKFYKKHGVAMPTETTTNITHNRVVVEAPKTSGFKVYPKNNADII
LPLVPSREVAMDKIILIGSSTGGTEALIECLKNVTPSAPPIVIAQHMPEHFTTSFARRLN
TVLKIEVFESEDGMSIGRGQAVLARGGKHTMIKVKNGKYYIEVVDGEPVTRHKPSVDVLF
RSGAVYAKNKAIGIILTGMGDDGANGMKEMKDAGAYNIAQNEETCTVFGMPREAIARGGV
DEILPLDRILAAALKKA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctaataaaattaaagttttatccattgatgatagtgcattgataagacaattgctt
acaaaaattgttaattctgaccctgatttggaaatggttgccactgctgctaaccctata
cttgcagaggctaaattaaaaactataaaacctgatattattactttagatatagaaatg
cctgaaatggacggtattacttatcttaaaaaacttatgattaataatcctattcctgta
ataatgtttagttctttgcttgataaacatagagaattagcattagatgctttaaatatt
ggtgcttttgattatgttattaagccttctgctaatgtaagaggcggtgttgaggaacta
gctacagatttagttgaaaagataaaaaacgcttataacaacagagctaagttttataaa
aagcatggtgttgctatgcctacagaaactactactaatattactcataatagagttgtg
gtagaagctcctaaaacttcaggatttaaagtttatccaaaaaataatgctgatattata
cttccgcttgtaccttctagagaagttgctatggataaaattatacttataggctcttct
acaggcggtactgaggctttgatagaatgtttaaaaaatgttacaccttctgctcctcct
atagtaatagctcagcacatgcctgaacattttactacttcttttgctaggagattgaat
actgtattaaaaatagaagtttttgaatctgaagatggtatgagtataggacgcggtcag
gcagtacttgcaagaggcggaaagcatactatgataaaagttaaaaatggaaagtattat
attgaagttgtagatggtgagcctgttactagacataaaccttctgtagatgtacttttt
agaagcggtgctgtatatgctaaaaataaagctataggtatcatacttactggaatgggt
gatgatggtgctaatggtatgaaagaaatgaaagatgccggtgcttataacattgctcaa
aacgaagagacttgtactgtttttggtatgccaagagaggctattgctagaggcggtgta
gatgagatacttccgcttgatagaatattagccgctgctcttaaaaaagcataa

DBGET integrated database retrieval system