KEGG   Brachyspira pilosicoli P43/6/78: BPP43_01415Help
Entry
BPP43_01415       CDS       T02387                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPP43_01415
DNA repair and recombination proteins [BR:bpip03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BPP43_01415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296738..297346
Genome map
AA seq 202 aa AA seqDB search
MSGIDSLDKLTQMISRLPGIGGRSAMRIALYLFDSDDEYLSELSNSILSLHKNIKLCREC
YSLSENDICNICASDKRDRTKLCIVESYTDMIAIEKTEEYNGIYHVLGGLIEPLKGIGIS
DIRIKELIDRVKDNSSIEEIIIAFGASLEADTTASYINKTLRNNNFDKKISRITYGISLA
SDIENADSRSLARSIADRVVMQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggtattgattctttagataagcttacacagatgatatctagacttcctggaata
gggggaaggagtgctatgcgtattgctttgtatttgtttgacagtgatgatgaatattta
agcgagttatctaattctattttgtcgctgcataaaaatataaagctttgcagagaatgt
tattctttgagtgagaatgacatttgcaatatatgtgcaagtgataaaagagacagaaca
aagctatgcatagttgaatcttatacagatatgattgccatagaaaaaacagaagaatac
aatggtatttatcatgttttaggaggattaatagagcctcttaaaggaataggtatttca
gatataagaataaaagaattaatagatagagttaaagataatagctcaatagaagaaatt
attatagcatttggtgcttcattagaggcagatactacagcatcgtatataaataaaact
ttgagaaacaataatttcgataaaaaaataagccgcattacgtatggtatatcattagca
agcgatattgaaaatgctgattcacgttcattagcaagaagcattgcagacagagtagtt
atgcagtag

DBGET integrated database retrieval system