KEGG   Brachyspira pilosicoli P43/6/78: BPP43_01465Help
Entry
BPP43_01465       CDS       T02387                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BPP43_01465
Enzymes [BR:bpip01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     BPP43_01465
Amino acid related enzymes [BR:bpip01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BPP43_01465
Transfer RNA biogenesis [BR:bpip03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BPP43_01465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306145..307590
Genome map
AA seq 481 aa AA seqDB search
MSDIRVRFAPSPTGFLHIGNARTALFNWLYAKSIKGKLILRIEDTDQERSTKEAVDMAIK
SLKWLGIDWDEGPEVGGNYGPYFQSERLDIYKKYTEKLMEEGKAYYCFCTSEELEKKSNM
QKTLNQPIIYDGKCKDIPLEEAKRRVANGEPAKIRFRVPKNQQIVFEDFVRGVVKTNSDE
IGDIIIVRENGFPTYNYAVVIDDMLMKISHVIRGEDHISNTPKQILIYEALGAEVPRFAH
TSSILGNDRKKLSKRHGAATLMEYKDEGFLPQAMRNFLALLGWTHPEAMENMNDEDMIKA
FTLDRFSKSPAIFDTAKLRHLNAWHIKNLDLDEATELFLPYLIQGGFLKENYTEEEHAWA
KKLISVIRHNCVVLSDIVKYVPVFFENDFELTDEMKEIVNKEESKKLLQFIKTNIENANE
ITDQYMKDLIKQAQKETGLKGPNLYHPIRYVITGSSAGTELSHICELLGKENILYRLSKY
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattagagttcgttttgctccatctccaactggttttttacatataggaaat
gcaagaacagcgttatttaattggctttatgctaaatctataaaaggaaaattaatttta
agaatagaagatacagatcaagagagaagcacaaaagaagctgttgatatggctataaaa
tcattaaaatggcttggaattgattgggacgagggtccggaagttggcggaaattatggt
ccatattttcaatctgaaagacttgatatatataaaaaatacactgaaaaacttatggaa
gagggtaaggcatattattgtttttgtacttctgaagagttagaaaaaaagtctaatatg
cagaaaactctaaatcagcccattatttatgacggcaaatgtaaggatataccattagaa
gaggctaaaagaagagttgctaatggagagcctgctaaaataagatttagagtgcctaaa
aatcagcagatagtatttgaagattttgttaggggcgttgttaaaactaatagtgatgaa
attggcgacattatcattgttagagaaaatggttttcctacttataattatgctgtagtt
atagatgatatgcttatgaaaatttctcatgttataagaggagaggaccatatatctaat
actccaaaacaaatacttatttatgaagcattgggagcagaagttcctagatttgctcat
acttcttcaatacttggtaatgatagaaagaaattatcaaaaagacatggtgctgctact
ttaatggaatataaagatgaaggattcttgcctcaagctatgagaaacttccttgcttta
cttggttggactcaccctgaagctatggaaaatatgaatgatgaagatatgattaaagca
ttcactttagatagattttctaagagtcctgctatatttgataccgctaaattaagacat
ttaaatgcttggcatattaaaaatcttgatttggacgaggctactgaattatttttacct
tatcttatacaaggcggattcttaaaagaaaattatacagaagaagaacatgcttgggct
aaaaaacttatatctgtaataagacataattgtgttgttttatctgatattgttaaatat
gttcctgtattttttgaaaatgattttgaacttacagatgaaatgaaagagattgtaaat
aaagaagaaagtaaaaagcttcttcagtttattaaaactaatatagaaaatgctaatgaa
ataactgaccaatatatgaaagatttaataaaacaagctcaaaaagaaactggtcttaaa
ggccctaatttgtatcaccctataagatatgtaataacaggaagcagtgctggtactgag
ttatcacatatatgcgagcttttgggtaaagaaaatattttatacagattatctaaatat
atataa

DBGET integrated database retrieval system