KEGG   Brachyspira pilosicoli P43/6/78: BPP43_01660Help
Entry
BPP43_01660       CDS       T02387                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpip00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bpip00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bpip00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
349141..351333
Genome map
AA seq 730 aa AA seqDB search
MISIIENHKKRKLFFLNTISSSLVLMVHEDNYVFMPYWGAKIEANNIDYIIDEITEANYM
AYTDNRKKFQLEVIPQIYPSYGYTDLKEPAFHFLHRDGSRITDLRYKSHNIYKTKKKLEG
LPTVLSDEHSEVLELVLFDELKKIEVTITLAVFEKYNAITKSVKVINKHETDSLYIEKIM
SANIDLQESNFELLHLSGAWGRECHIKRRKLEQGMQSIGSVRGASGHGQNPFAALISPNA
DENNGEVYAMNFVYSGNFKASVEVDMHLNTRFQMGINDFDFGWTLMPNEKFQTPEAVLVY
TNKGLGDMSRTFHKLYQDCLMSKKYAYKERPILINSWESNYFDFNKESLLKLAKEAKNIG
AELFVLDDGWFGKRDDDKSSLGDWIPNEKKLGGSLSALIDDINKTGLSFGLWFEPEMVSP
DSDLFRKHPEWAIQVKGRKIETSRYQYVLDLSNPEVCGYIINFMTDILSKNNISYVKWDM
NRNITNLGSSYLKPEKQKEQSHRYMLGLYSVLENIVNAFPNILFESCAGGGGRCDAGMLY
YMPQVWTSDDTDAIERLAIQYGASLIYPSISLACHISDIPNHQTHRKETIETRANVAMWG
NLGLELNLNKISKEDKKIISEKLEVYKLIRSTVQFGSLYRLKGLDYGNEYAWLHKSIDEK
TIVVNYVQINMVPNLLTKRLRLEALEPKSKYKVNDFDKIYTGEELMNIGLVLGEIVEDAI
AIQWIIKKID
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgattagtattatcgaaaatcataaaaaaagaaaactattctttttaaacactatctca
tcatctttagtattaatggttcatgaagataattatgtatttatgccttattggggggca
aaaatagaggcaaacaatatagattatattattgatgaaataactgaagctaattatatg
gcatatactgataatagaaaaaaatttcagcttgaagtaatacctcaaatatatccttct
tacggttacacagatttaaaagaaccagcatttcattttctacatagagacggttcaaga
ataacagacttgcgttataaatcacataacatatataaaactaaaaagaaattagaagga
cttcctacagtgttatcagatgagcatagtgaagtattagaattagttttatttgatgag
ttgaaaaaaattgaagtaacaattactttagctgtatttgaaaaatataatgcaataaca
aaatcagtaaaagtaataaataaacatgaaacagattctttatacatagaaaaaataatg
tcagcaaatatagaccttcaggaatcaaattttgaattgcttcatttgtctggtgcttgg
ggaagagaatgtcatattaagagaaggaaattagagcagggaatgcagtctataggaagt
gtgagaggtgcatcaggacatggtcaaaacccctttgctgctttaatatctcctaatgct
gatgaaaataatggggaagtatatgctatgaatttcgtatacagcggaaattttaaagca
agtgttgaagtggacatgcatttaaatactagatttcaaatgggaataaatgattttgat
tttggttggacattaatgcctaatgaaaagtttcaaactcctgaagctgtgcttgtatat
acaaacaaaggtttaggtgatatgtcgagaactttccataaactttatcaagattgtttg
atgtcaaaaaaatatgcttataaagagcgtcctattttgataaacagttgggaatccaat
tattttgattttaataaagaaagtcttttaaaattagctaaagaggcaaaaaatatagga
gctgaattatttgtattagatgatggttggtttggtaaaagagatgatgataaaagttct
ttgggagattggatacctaatgaaaaaaaacttggcggaagtttgtctgctttgatagat
gatataaataaaactggattaagttttggattatggtttgaacctgaaatggtatctcct
gatagtgatttatttagaaaacacccagagtgggctattcaagttaaaggcagaaaaata
gagacttcaagatatcagtatgtattagatttaagtaatcctgaagtatgcggctatata
ataaactttatgactgatattttatcaaaaaataatatttcttatgttaaatgggatatg
aatagaaatattacaaatttaggttcatcttatctaaaacctgaaaagcaaaaggaacaa
tctcatagatatatgttaggtctttacagtgtattagaaaatattgttaatgcatttcct
aatatattatttgaaagctgtgcaggaggcggcggaagatgcgatgctggtatgctttat
tatatgcctcaggtttggacaagtgatgatactgatgctatagaaagactcgctatacaa
tatggagcttctttaatttatccttcaatatctttagcttgccatatttctgatatacct
aatcatcaaacacataggaaggaaactatagaaacaagagcaaatgttgctatgtggggt
aatttgggattagaattaaacttaaataaaataagtaaagaagataaaaaaattatatca
gaaaaattggaagtttataaactcataagaagtactgttcagtttggaagtctttacaga
ttaaaaggtttagattatggtaatgaatatgcttggcttcataagagtattgatgaaaaa
actatagttgtaaattatgtgcaaataaatatggttcctaatttattaacaaagcgtttg
cgtttagaggcattagagcctaaaagtaaatataaagtaaatgactttgataaaatctac
actggagaagagttaatgaatattgggcttgtgcttggagagatagtggaagatgctata
gctattcaatggataataaaaaagattgattaa

DBGET integrated database retrieval system