KEGG   Brachyspira pilosicoli P43/6/78: BPP43_01785Help
Entry
BPP43_01785       CDS       T02387                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPP43_01785
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPP43_01785
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BPP43_01785
Enzymes [BR:bpip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BPP43_01785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374669..375724
Genome map
AA seq 351 aa AA seqDB search
MKAWNGLLREYREYLPITDKTPLITLHEGNTPLIKAEKIGKELGGIELYFKYDGLNPTGS
FKDRGMVMAVAKALEEGSKAIMCASTGNTSASAAAYAARSGIQCIVVIPDGNIALGKLAQ
ALMYGAKVIAIKGNFDEALKAVVDITNKYPITLVNSINPFRLQGQKTSAFEICDTLGKAP
DYLAIPVGNAGNISAYWMGFKEYKENGKVSNLPKMIGFEAEGSAAIVQNRVIENPQTLAT
AIKIGNPASWKLAVNAANESNGFIDSVTDDEILEAYKMLTREEGIFAEPASAASLAGVIK
TYKAGKLKKGDVVVSVLTGNGLKDPDNAIKICSAPIKVDNNIEEIRKAIGI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatggaacggacttttaagagaatatagagaatatttaccaattacagataaa
accccattaataacattgcatgaaggaaatactccattaataaaagcagaaaagatagga
aaagaacttggaggcatagaattatatttcaaatatgacggacttaaccctacaggttca
tttaaagacagaggaatggtaatggcagttgctaaggcacttgaagaaggctcaaaggct
ataatgtgtgcttctacaggaaacacttctgcatctgcagcagcatatgcagcaagaagc
ggtattcaatgtatagtggttattccagatggaaatattgctttaggaaaattagcacag
gctttgatgtatggtgctaaggttatagctattaaaggtaattttgatgaagcattaaag
gctgttgtggatattacaaataaatacccaattacattggtaaactctattaacccattt
aggcttcaaggtcaaaaaacttctgcatttgagatttgcgatactttaggaaaagctcct
gattatttggctatacctgttggaaatgctggaaatatatctgcatattggatgggtttt
aaagaatataaagaaaacggaaaggtatcaaacttaccaaagatgataggttttgaggct
gaaggctctgctgctatagtacaaaacagagtaatagaaaatcctcaaactttggctact
gccataaagataggtaatcctgctagttggaagttagctgttaatgctgctaatgaatct
aatggttttatagactctgttactgatgatgaaatattagaggcttacaaaatgcttaca
agagaagagggtatatttgctgagcctgcttctgctgcttctttggctggagttataaaa
acttacaaagcgggtaaacttaaaaaaggtgatgttgtagtttctgtacttacaggaaat
ggacttaaagaccctgataatgcaataaagatttgttctgctcctataaaagttgataac
aatatagaagagataagaaaagctataggaatatga

DBGET integrated database retrieval system