KEGG   Brachyspira pilosicoli P43/6/78: BPP43_01785Help
Entry
BPP43_01785       CDS       T02387                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
bpip00260  Glycine, serine and threonine metabolism
bpip00750  Vitamin B6 metabolism
bpip01100  Metabolic pathways
bpip01110  Biosynthesis of secondary metabolites
bpip01120  Microbial metabolism in diverse environments
bpip01230  Biosynthesis of amino acids
Module
bpip_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPP43_01785
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BPP43_01785
Enzymes [BR:bpip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BPP43_01785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AGA65689
Position
374669..375724
Genome map
AA seq 351 aa AA seqDB search
MKAWNGLLREYREYLPITDKTPLITLHEGNTPLIKAEKIGKELGGIELYFKYDGLNPTGS
FKDRGMVMAVAKALEEGSKAIMCASTGNTSASAAAYAARSGIQCIVVIPDGNIALGKLAQ
ALMYGAKVIAIKGNFDEALKAVVDITNKYPITLVNSINPFRLQGQKTSAFEICDTLGKAP
DYLAIPVGNAGNISAYWMGFKEYKENGKVSNLPKMIGFEAEGSAAIVQNRVIENPQTLAT
AIKIGNPASWKLAVNAANESNGFIDSVTDDEILEAYKMLTREEGIFAEPASAASLAGVIK
TYKAGKLKKGDVVVSVLTGNGLKDPDNAIKICSAPIKVDNNIEEIRKAIGI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatggaacggacttttaagagaatatagagaatatttaccaattacagataaa
accccattaataacattgcatgaaggaaatactccattaataaaagcagaaaagatagga
aaagaacttggaggcatagaattatatttcaaatatgacggacttaaccctacaggttca
tttaaagacagaggaatggtaatggcagttgctaaggcacttgaagaaggctcaaaggct
ataatgtgtgcttctacaggaaacacttctgcatctgcagcagcatatgcagcaagaagc
ggtattcaatgtatagtggttattccagatggaaatattgctttaggaaaattagcacag
gctttgatgtatggtgctaaggttatagctattaaaggtaattttgatgaagcattaaag
gctgttgtggatattacaaataaatacccaattacattggtaaactctattaacccattt
aggcttcaaggtcaaaaaacttctgcatttgagatttgcgatactttaggaaaagctcct
gattatttggctatacctgttggaaatgctggaaatatatctgcatattggatgggtttt
aaagaatataaagaaaacggaaaggtatcaaacttaccaaagatgataggttttgaggct
gaaggctctgctgctatagtacaaaacagagtaatagaaaatcctcaaactttggctact
gccataaagataggtaatcctgctagttggaagttagctgttaatgctgctaatgaatct
aatggttttatagactctgttactgatgatgaaatattagaggcttacaaaatgcttaca
agagaagagggtatatttgctgagcctgcttctgctgcttctttggctggagttataaaa
acttacaaagcgggtaaacttaaaaaaggtgatgttgtagtttctgtacttacaggaaat
ggacttaaagaccctgataatgcaataaagatttgttctgctcctataaaagttgataac
aatatagaagagataagaaaagctataggaatatga

DBGET integrated database retrieval system