KEGG   Brachyspira pilosicoli P43/6/78: BPP43_02405Help
Entry
BPP43_02405       CDS       T02387                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase/aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BPP43_02405
Enzymes [BR:bpip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BPP43_02405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(504674..505384)
Genome map
AA seq 236 aa AA seqDB search
MATANRKDLAKSIIEACLNMRKDGVNQGTAGNISIRFKDGMLITPSGMPYEIMTPDDIVF
VDGNGKPEKDKIPSSEWRFHLSILKDNPTFNAVIHNHAIYSSMVSILNIDYIPAIHYMVG
VAGGNKIPCVKYATYGTQELCDNISKSMKGYKACILKNHGLLAADETLQKAYHVMMEVEN
LARLYMGVRGIGDYSILSDAEMEIVLEKFKNYGLNVKHKTKKTTKTTVKSSKSKKK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggctactgcaaacagaaaagatttagctaaaagcataatagaagcttgtttaaatatg
agaaaagatggtgttaatcaaggtactgctggaaacataagcataagatttaaagatggt
atgcttattacaccttcaggtatgccttatgagattatgacgcctgatgatattgttttt
gtagatggtaatggaaaaccagaaaaagataaaataccttcaagcgaatggagatttcat
ttatctattcttaaagataaccctacttttaatgctgtaatacataatcatgctatttat
tcatctatggtttctattttaaatatagattatattccagctattcattatatggtaggc
gttgcaggaggaaataaaattccttgtgttaaatatgcaacatacggcactcaagaatta
tgcgacaatatttctaaatctatgaaaggatataaggcttgcatactcaaaaatcatgga
cttttagctgctgatgaaacattacaaaaagcatatcatgttatgatggaagttgaaaat
ctagctagattatatatgggagtaagaggtattggtgattactctattttatctgatgct
gaaatggaaattgttttagaaaaattcaaaaattatggtcttaatgtaaaacataaaact
aaaaaaacaacaaaaacaacagttaaatcttctaagtctaagaagaaatga

DBGET integrated database retrieval system