KEGG   Brachyspira pilosicoli P43/6/78: BPP43_02430Help
Entry
BPP43_02430       CDS       T02387                                 

Gene name
fucI
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BPP43_02430 (fucI)
Enzymes [BR:bpip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     BPP43_02430 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
510935..512716
Genome map
AA seq 593 aa AA seqDB search
MFRMQNNLPKVGIRPVIDGRRNGVRESLEDTTMNMAKIAAKLIEENIKHPSGEKVECVIA
DTTIGGVAEAARCQKKFDENNVKLTLTVTPCWCYGSETIDMTPVIPKAIWGFNGTERPGA
VYLAAADAGHTQLGLPVFSIYGKDVQDAGDENVPDDVKEKILRFVRAGLAVATMRDQSYI
SMGYVAMGIMGSMVDAEFLLDYLGMRTEFVDMSEIKRRLELEIYDKEEFKKAWEWAKQCK
FGVDKNKVQATAEEKEKEWATSIKMAMIMRDLMVGNPKLAEMGYIEEAQGHNAIVGGFQG
QRHWTDFMPNGDFAEAILNSSFDWNGIREPYVVATENDSLNGLSMLFAHLLTCKSQLFAD
VRTYWSPEAVKRVTGKELTGKAKNGIIHLINSGAASLDWTGEQKIGGNPALKEYWNITEE
EAKKCLDATEFSPASREYFRGGGFSSTFLTKGEMPMTIIRLNLVKGYGPVLQIAEGYAVN
IDNSIFDPINKRTDSTWPTTWFAPILTGKDSFKDVYSVMNDWGANHCAAAYGHIGADLIT
LASMLRIPVSMHNVSEERIFRPKAWKAFGTKDLEGADFRACKHFGPLFGKVTK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaatgcaaaataatttgcctaaagtaggtataagacctgttatagatggtagg
agaaacggagttagagaatctctcgaagacactactatgaacatggctaaaatagctgct
aagctaatagaagaaaatattaaacaccctagcggagaaaaagttgaatgtgtaatagct
gatactacaatcggcggtgttgctgaagctgctagatgtcagaaaaaatttgatgaaaat
aatgttaaattaactcttactgttacaccttgttggtgttatggttctgagactattgat
atgactcctgttatacctaaagcaatttggggatttaatggtactgaaagacctggagca
gtttacttggctgctgctgatgcaggacacactcaattaggacttcctgtattttctatc
tatggtaaagatgttcaagatgcaggtgatgaaaatgttcctgatgatgttaaagaaaaa
atattaagatttgtaagagctggacttgctgttgctactatgagagatcaatcatacata
agcatgggatatgttgctatgggtattatgggctctatggttgatgctgagtttttactt
gactatttaggaatgagaactgaattcgtagatatgagtgaaatcaaaagaagattagaa
ctagaaatctatgataaagaagagttcaaaaaagcatgggaatgggctaaacaatgtaag
tttggagtagataaaaataaagtacaagctactgctgaagaaaaagaaaaagagtgggct
acttctataaaaatggctatgattatgcgtgacttaatggtgggcaatcctaagttagca
gaaatgggatatatagaagaagcacaaggtcataatgctatagttggcggtttccaaggt
caaagacattggactgactttatgcctaatggagactttgctgaagctattcttaactca
tcttttgactggaacggtataagagagccttatgttgttgctactgaaaatgactctttg
aatggtctttctatgctatttgctcatttattaacttgcaaatctcagcttttcgcagat
gttagaacttattggagtcctgaggcagttaaaagagttactggtaaagagcttactggt
aaagctaaaaacggtatcattcacttaattaactctggtgctgcttctttagactggact
ggagagcaaaagattggcggaaatcctgctttgaaagaatattggaatatcactgaagaa
gaggctaaaaaatgtcttgatgctacagagttctctcctgcaagcagagaatactttaga
ggaggcggattctcatctactttcttaactaaaggtgaaatgcctatgactataatcaga
cttaatttagttaaaggttatggtcctgtacttcaaatagctgaaggttatgctgttaat
attgataatagtatatttgaccctattaacaaaagaactgactctacttggcctactact
tggtttgctcctatacttacaggtaaagattctttcaaagatgtttattctgtaatgaat
gattggggtgctaatcactgtgctgctgcttatggtcatattggtgctgatttaattaca
ttagcttctatgctccgtatacctgtaagtatgcataacgtaagtgaagagagaatattt
agacctaaagcttggaaagcatttggtacaaaagatttagaaggtgctgattttagagct
tgtaaacattttggacctttgtttggaaaagtaactaaataa

DBGET integrated database retrieval system