KEGG   Brachyspira pilosicoli P43/6/78: BPP43_04070Help
Entry
BPP43_04070       CDS       T02387                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPP43_04070
   00670 One carbon pool by folate
    BPP43_04070
Enzymes [BR:bpip01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BPP43_04070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(851733..852233)
Genome map
AA seq 166 aa AA seqDB search
MIVSLIAAVDSKNGIGLNGVMPWGHIKEDMQFFRSTTTGYAVVMGRVTFESLGGKPLPNR
KNIVISSNKNELSDKYDNLFYENSFENAISKLLLEKHNQIFIIGGESIYKRAMDYADKIY
LTHINKNYNCDRFFPEVDSKLFSSRILKNFVYDDIDVSIVEYTKDF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgatagtttcattaatcgctgctgttgattcaaaaaacggcataggattaaatggtgta
atgccttggggacacattaaagaggatatgcagttttttagaagcactaccacaggatat
gctgttgttatggggagagttacttttgagtcattagggggaaagccgcttccaaataga
aaaaacattgttatatcatctaataaaaatgagctttcagataaatacgataaccttttt
tatgaaaatagttttgaaaatgctatttctaaattattattagaaaagcataatcaaata
tttattataggaggggagtccatttataaaagagcaatggattatgcagataaaatatat
cttactcatataaataaaaattataattgcgacagattttttccagaagtagatagtaaa
ttattttcttcaaggatattgaagaactttgtttatgatgatatagatgttagtattgtg
gaatatactaaagatttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system