KEGG   Brachyspira pilosicoli P43/6/78: BPP43_04310Help
Entry
BPP43_04310       CDS       T02387                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPP43_04310
Enzymes [BR:bpip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BPP43_04310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
903212..904366
Genome map
AA seq 384 aa AA seqDB search
MKKRVLILGATGSIGVNTCSVIEHFYNDFEIVGITTNTKIDVLKEECIKFKPKYVHISSK
EALDNFKNFNIDVNIHEGSIADFVKDIDFDILVNALVGYSGFLPTIEAIKKSKVVALANK
ETLVVGGDIINDLLKKHNAKLVPIDSEHSAIFQILNHFKNVPISKVIITASGGPFFRTPK
EELKNVTVEMALKHPTWNMGGKITIDSATMMNKGFEVIEAHHLFNLDYDKIETIIHPQSL
IHSMVEFVDGEIYAQIGKNDMRLPIQHALTYPEVRTTPFEKLKLYEHSEINFYKMDFDKF
IMLKLAYECGKKGGLYPCILNAANEVCVYSFLEKKISFTEIFDIVEKMVKINVDHIPLTV
ENIIKIDNETRKETLKLIETIKQM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagagttctcatacttggtgccaccggttctataggagtaaacacttgctct
gtaatagaacatttttataatgactttgaaatagtaggaattactacaaatactaaaatt
gatgttttaaaagaagaatgcattaaattcaagccaaaatatgtgcatatatcttctaaa
gaagcattagataattttaaaaattttaatatagatgttaatattcatgaaggaagcata
gctgattttgtaaaagatattgattttgatatactagtaaatgctttagtaggatattct
ggttttcttccaacaatagaagcaataaaaaaatctaaagttgtagcattagcaaataaa
gaaacattagttgtaggcggagatataattaatgatttattaaaaaaacataatgctaaa
ttagtaccaatagacagcgaacattctgcaatttttcaaatattaaatcattttaaaaat
gtaccaatatcaaaagtaataataacagcatcaggaggacctttctttagaactccaaaa
gaagagttaaaaaatgttacagtagaaatggcattaaaacacccaacttggaatatgggc
ggaaaaattacaatagacagtgccactatgatgaacaaaggttttgaagtaatagaagct
catcatttatttaatttggattatgacaaaatagaaactataatacaccctcaaagttta
atacattctatggttgagtttgtagacggagagatatatgctcaaattggaaagaatgat
atgcgtcttcctatacagcatgccctcacctacccagaagtaagaacaacaccatttgaa
aaattaaagctttatgaacatagcgagattaatttttataagatggattttgataagttt
attatgcttaaacttgcatatgaatgcggtaagaaaggcggactatatccttgtatatta
aatgctgctaatgaagtatgtgtgtattcatttttagagaaaaaaatatcatttactgaa
atatttgatatagtagaaaaaatggtaaaaataaatgttgatcacataccgcttactgta
gaaaatattataaaaatagacaatgaaactagaaaagaaactttaaaattaatagaaact
ataaaacaaatgtga

DBGET integrated database retrieval system