KEGG   Brachyspira pilosicoli P43/6/78: BPP43_06465Help
Entry
BPP43_06465       CDS       T02387                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPP43_06465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP43_06465
   00052 Galactose metabolism
    BPP43_06465
   00500 Starch and sucrose metabolism
    BPP43_06465
   00520 Amino sugar and nucleotide sugar metabolism
    BPP43_06465
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BPP43_06465
   00524 Butirosin and neomycin biosynthesis
    BPP43_06465
Enzymes [BR:bpip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BPP43_06465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1365450..1366403)
Genome map
AA seq 317 aa AA seqDB search
MKDAVIALDIGGTSIKGAIINEEGNILYKDSFNIEANFTSEEHKTNIANIIKKLLENMPS
EYNAIGIGLDCPGVMNSETLHMGGAENVPGLHGIKFSDIGDLFDLPIKTANDASMAALGE
AKYGSGKDKEYKSVMFITLGTGVGGGFVFNGKLFTGSLGGAGEVGHVFVVPDGDKCNCGS
SGCIERYASATGFIAMAKQKIHKNVVPTTLTYEELEKGKAKAIFDAAKKGDALAKETIAE
CSYYLGMSIAQALNMLDLDLVLIGGGLCKDFDMMIEHIKRGVNNYGLRMMVRNLEIKPAS
LGNDAGVLGCAAMFFRN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgctgttattgctttagatataggaggcacttcaataaagggtgctataatt
aatgaagagggaaatattttatataaagatagctttaatatagaagctaattttacctct
gaagaacataagacaaatatagcaaatataataaaaaagcttttagagaatatgccttca
gaatataatgctataggaattggtttagattgtcctggagttatgaactctgagacgctt
catatgggaggagcagaaaatgttcctggtttgcatggtattaagttttctgatataggt
gatttatttgatttgcctataaaaactgccaatgatgctagtatggctgcattaggtgag
gctaaatacggaagcggtaaggataaagaatataaatctgtaatgtttattacacttggc
actggtgtaggcggaggatttgtatttaacggaaaattatttacaggttctttgggagga
gctggtgaagtagggcatgtatttgtagttcctgatggtgataaatgtaattgcggttca
agcggctgtatagagcgttatgcttctgctactggttttattgctatggctaaacaaaag
attcataaaaatgttgttcctactactttaacttatgaggaattagaaaaaggtaaggct
aaggctatatttgatgctgctaaaaaaggagatgctcttgctaaagagactattgcggag
tgttcttattatttaggtatgtctatagcacaggctttgaatatgcttgatttggatttg
gttcttataggcggtgggctttgtaaagattttgatatgatgatagagcatattaaaaga
ggcgttaataattatggtcttagaatgatggtaagaaatcttgaaataaaacctgcttct
ttaggaaatgatgccggtgtattaggctgtgctgctatgttttttagaaattaa

DBGET integrated database retrieval system