KEGG   Brachyspira pilosicoli P43/6/78: BPP43_07365Help
Entry
BPP43_07365       CDS       T02387                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BPP43_07365
Enzymes [BR:bpip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BPP43_07365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1554679..1555548
Genome map
AA seq 289 aa AA seqDB search
MSKKILVIGSINKDLVITTPRFPKEGETILGNNFYTANGGKGANQACAIGKLGGNVAMLG
AIGNDNFGKDLSNALYSNNVNIDNLLIKNDISTGIAVITVTNDGANHIIVAQGANALITK
DDIKEKLIASFDIIVMQLEIPLEIAKYAASIAKKLGKTVVLNPSPAVKLDRDFLSCVDIL
IPNETEIDIIGGIDYVLECGVKNIILTLGADGCELITKQNRKHFDAYKVNVVDTTAAGDS
FLGGVVRMIADDKTIEEAIEFATKVSNITVTRKGAIDSIPTYNEVIDNY
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaaattttagttataggaagtataaataaagatttagttatcacaactcca
cgttttcctaaagaaggtgaaactatacttggcaataatttttatactgctaatggcggt
aagggagcaaatcaggcatgtgccataggtaaattgggtggaaatgtagccatgcttggt
gctattggaaatgataattttggtaaagatttatcaaatgctttatattctaataatgtt
aatatagataatttattaataaaaaatgatatttctacaggtatagctgttattacagtt
actaatgatggagctaatcatattattgtagcacaaggagctaatgctttaattacaaaa
gatgatatcaaagaaaaattaattgcatcatttgatataatagttatgcaattggagata
cctttagaaatagcaaaatatgctgcatctattgctaaaaaacttggtaaaactgttgtg
ttaaatccttcccctgctgtaaaactagatagagatttcttaagctgtgtagatatacta
attccaaatgaaacagaaatagatattataggtggtattgattatgtacttgaatgcgga
gttaaaaatataatacttactttaggtgctgatggatgcgagcttataacaaaacaaaat
agaaaacattttgatgcatataaagttaatgttgttgatactactgctgcaggagacagt
tttttaggcggagttgtaagaatgattgctgacgataaaactattgaagaggctattgaa
tttgctactaaagtttctaatataactgttactagaaaaggagcaatagattctatacct
acatataatgaagtaattgataactattaa

DBGET integrated database retrieval system