KEGG   Brachyspira pilosicoli P43/6/78: BPP43_07925Help
Entry
BPP43_07925       CDS       T02387                                 

Definition
(GenBank) family 1 glycoside hydrolase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
bpip00010  Glycolysis / Gluconeogenesis
bpip00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP43_07925
   00500 Starch and sucrose metabolism
    BPP43_07925
Enzymes [BR:bpip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BPP43_07925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF3997
Motif
Other DBs
NCBI-ProteinID: AGA66791
Position
1670881..1672305
Genome map
AA seq 474 aa AA seqDB search
MPFKEGFLWGGATAANQCEGGFNKGGRGLANVDVAPHGKDRVAVIKGKMKMFDFDNEHFY
PSKDAIEMYTHYKEDIKLFAEMGFKVYRMSIAWSRIFPKGDEEKPNEEGLKFYEDVFKEC
LKYNIKPLVTITHFDCPMHLITKYGGWKNRIMIKFYENLCNVIFNRYKGLVEYWLTFNEI
NMILHAPFMGAGLYFEEGENEEEMKYQASHHELVASAIATKIAHEVDPNNKVGCMLAAGI
YYPYSSKPEDVLAAQHKNDEMYFFVDVQSRGKYPNYALKKFERENLNIKMEKEDLDILAK
YTVDFISFSYYSTRCATADKSKYTITKDNLEGDIKNPELKQTDWGWTVDPLGIRITLNDI
YDRYQKPMFIVENGLGAYDKPDENGYVEDDYRIEYLREHIKNMKDAVEIDGVDLIGYTTW
GPIDLVSAGTGEMSKRYGFIYVDRDDFGNGTLKRSKKKSFYWYKQVIDSNGENL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgccatttaaagaaggttttttatggggcggagctaccgcagcaaatcaatgcgaaggc
ggatttaataaaggcggaagaggtttagctaatgtagatgttgctccgcatggtaaagat
agagttgctgttattaaaggaaaaatgaaaatgtttgattttgataatgaacatttttat
ccttcaaaagacgctatagaaatgtatactcattataaagaagatataaagctttttgct
gagatgggttttaaagtttacagaatgtctattgcttggagcagaatatttcctaaaggc
gatgaagaaaagcctaatgaagaaggcttaaaattttatgaagatgtatttaaagagtgc
ttaaaatataatataaaacctttagtaactatcacacattttgactgccctatgcattta
attacaaaatacggcggttggaaaaatagaataatgataaaattttatgagaatctttgt
aatgttatatttaatagatacaaaggtttagttgaatattggcttactttcaatgaaata
aatatgattttgcatgcaccttttatgggagctggactttattttgaagaaggcgaaaac
gaagaagaaatgaaatatcaggcaagccatcatgaattggttgctagtgcaatagctact
aaaatagctcatgaagtagaccctaataataaagttgggtgtatgttggctgcaggaatt
tattatccttactcttcaaaacctgaagatgtattggcagcacagcataaaaatgatgag
atgtatttctttgttgatgtacagtcaagaggaaaatatcctaattatgctttaaaaaag
tttgaaagagaaaacttaaacataaaaatggaaaaagaagatttagatatattagctaaa
tatactgttgattttatttctttctcttattattcaacaagatgtgctactgctgataag
agtaaatatacaataacaaaagataatttggaaggcgatataaaaaatcctgaattaaaa
caaactgattggggttggactgttgatccgcttggtataagaataactttaaatgacatt
tatgatagataccaaaaacctatgtttatagtagagaatggacttggtgcttatgataag
cctgatgaaaatggttatgtagaagatgattatagaatagagtatttgagagaacatata
aaaaatatgaaagatgctgttgaaattgatggggttgatttgataggatatactacttgg
ggacctatagatttggtttctgctggtaccggtgaaatgtctaagagatatggttttata
tatgtagatagagatgattttggaaatggaactctaaaaagaagcaagaaaaaatcattc
tactggtataaacaagttatagatagtaatggggaaaatttataa

DBGET integrated database retrieval system