KEGG   Brachyspira pilosicoli P43/6/78: BPP43_10395Help
Entry
BPP43_10395       CDS       T02387                                 

Definition
pyruvate oxireductase
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPP43_10395
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP43_10395
   00020 Citrate cycle (TCA cycle)
    BPP43_10395
   00620 Pyruvate metabolism
    BPP43_10395
   00640 Propanoate metabolism
    BPP43_10395
   00650 Butanoate metabolism
    BPP43_10395
  Energy metabolism
   00680 Methane metabolism
    BPP43_10395
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BPP43_10395
Enzymes [BR:bpip01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BPP43_10395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2168413..2169381
Genome map
AA seq 322 aa AA seqDB search
MGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKSFVRFSETEVRVNSTVEEPHVV
AVFHMNLLKNPLTLAGVKEDAIVIFNTNKTPDEARDFAKLHGGKVVCIDAIKIANDLKLP
SQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFGGRKAELVEPNIEAFRKGGSESVVKEFK
ADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDLQVTRTGNIPVFNPANCIDCAN
CEVVCPDLCIVWEKGPDRKDPNKTAMNMMGIDYQYCKGCLKCVRACPKGPYSGKFEKDQQ
ALRIEVEANCDVDKLTYRRYKK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctaatagtgctggtaaaatgcttgcagaagtaggcgttttaacacaaggtttc
tatggtgctgcattctcaagttatggttcagaaaagaaaggttctccagtaaaatctttt
gtaaggttttcagaaactgaagttagagtaaactctactgtagaagaaccacatgtagtg
gcagtgttccacatgaatcttctaaaaaaccctcttacattagctggtgttaaagaagat
gctattgttatttttaacactaataaaacacctgatgaggcaagagattttgctaaatta
catggcggtaaagtagtttgtattgatgcaataaaaatcgctaatgatttaaaacttcct
tcacaagctgctaatactatcataatgggtgctatggttaatcagcttgatttcatagat
tctgctaagtttgaagagcaaatcagaaaacaattcggcggaagaaaagctgaattagtt
gagccaaatattgaagctttcagaaaaggcggaagtgaatctgttgttaaagaattcaaa
gctgacggaaaatatccttatattccttataaaaaaccagaacctgtatatggtaaaaat
aaccaattaacaggcggttatatcaatgctgctggtaactctactttaaaagatttacaa
gttactcgtactggtaatatacctgtattcaatcctgctaactgtattgattgtgctaac
tgtgaagttgtttgtcctgacctttgtatcgtttgggaaaaaggaccagacaggaaagac
cctaataaaactgctatgaatatgatgggtatagattatcaatactgtaaaggttgttta
aaatgtgttagagcttgccctaaaggaccttattctggtaaatttgaaaaagatcagcag
gctttaagaatagaagtagaagctaattgtgatgttgataaacttacatacagacgttat
aaaaaataa

DBGET integrated database retrieval system