KEGG   Brachyspira pilosicoli P43/6/78: BPP43_10395Help
Entry
BPP43_10395       CDS       T02387                                 

Definition
(GenBank) pyruvate oxireductase
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPP43_10395
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP43_10395
   00020 Citrate cycle (TCA cycle)
    BPP43_10395
   00620 Pyruvate metabolism
    BPP43_10395
   00640 Propanoate metabolism
    BPP43_10395
   00650 Butanoate metabolism
    BPP43_10395
  Energy metabolism
   00680 Methane metabolism
    BPP43_10395
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BPP43_10395
Enzymes [BR:bpip01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BPP43_10395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2168413..2169381
Genome map
AA seq 322 aa AA seqDB search
MGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKSFVRFSETEVRVNSTVEEPHVV
AVFHMNLLKNPLTLAGVKEDAIVIFNTNKTPDEARDFAKLHGGKVVCIDAIKIANDLKLP
SQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFGGRKAELVEPNIEAFRKGGSESVVKEFK
ADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDLQVTRTGNIPVFNPANCIDCAN
CEVVCPDLCIVWEKGPDRKDPNKTAMNMMGIDYQYCKGCLKCVRACPKGPYSGKFEKDQQ
ALRIEVEANCDVDKLTYRRYKK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctaatagtgctggtaaaatgcttgcagaagtaggcgttttaacacaaggtttc
tatggtgctgcattctcaagttatggttcagaaaagaaaggttctccagtaaaatctttt
gtaaggttttcagaaactgaagttagagtaaactctactgtagaagaaccacatgtagtg
gcagtgttccacatgaatcttctaaaaaaccctcttacattagctggtgttaaagaagat
gctattgttatttttaacactaataaaacacctgatgaggcaagagattttgctaaatta
catggcggtaaagtagtttgtattgatgcaataaaaatcgctaatgatttaaaacttcct
tcacaagctgctaatactatcataatgggtgctatggttaatcagcttgatttcatagat
tctgctaagtttgaagagcaaatcagaaaacaattcggcggaagaaaagctgaattagtt
gagccaaatattgaagctttcagaaaaggcggaagtgaatctgttgttaaagaattcaaa
gctgacggaaaatatccttatattccttataaaaaaccagaacctgtatatggtaaaaat
aaccaattaacaggcggttatatcaatgctgctggtaactctactttaaaagatttacaa
gttactcgtactggtaatatacctgtattcaatcctgctaactgtattgattgtgctaac
tgtgaagttgtttgtcctgacctttgtatcgtttgggaaaaaggaccagacaggaaagac
cctaataaaactgctatgaatatgatgggtatagattatcaatactgtaaaggttgttta
aaatgtgttagagcttgccctaaaggaccttattctggtaaatttgaaaaagatcagcag
gctttaagaatagaagtagaagctaattgtgatgttgataaacttacatacagacgttat
aaaaaataa

DBGET integrated database retrieval system