KEGG   Brachyspira pilosicoli P43/6/78: BPP43_10750Help
Entry
BPP43_10750       CDS       T02387                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:bpip01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpip00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bpip00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bpip00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:bpip00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2240002..2241945
Genome map
AA seq 647 aa AA seqDB search
MKDKDYLELLSQKYPTIDDASVEIINLKAICKLPKGTEYFLSDIHGESEGFEYLIGTSSG
VIKEKIEILFRNTLTENERIELQILIVDTKNMINKKASKEDFNDWCRITIYRLIRICKLV
TSKYTRSKIRKKMPQNFAYILDELLQTSVEDNKENYYFSIIDSIIDVSASEKFIMALCAL
IRKCSIDRLHIVGDIYDRGPHPDKVIESIMNFNEVDMAWGNHDIHWLGAAKGSLICVANA
VRLAVRYNNFDLLEYSYGINLRALSSFANEVYKDDPCEVFKPNTLDKNIYDEVDKDLASK
MHKAISIIQFKLECQLIKRHPNYAMDERILLDKIDYKKGTINIDGKTYELKDKNFPTINP
KNPFELTEGENTLIQSLAFSFINSPTLQKHTNYIYAKGGIYKIFNGNLLYHGCIPTKEDG
SFDDVYIDGQYLSGKRYLKQVEDKVRKAFYCEVGSEEQLNALDYCWYLWCGPKSPLFGKN
KMTTFERYFIEDKETHKESYNSYYYHIDKKDYCESILKEFDLDIHKSHIVNGHVPVKTHK
GESPIKGGGILLVIDGGLSKAYHKSTGIGGYTLISNSNAMIIAEHRPFAEVVESGFRISP
KTTIVDRFVTRITVGETDIGIGLNKRISDLEELLNAYRNGIVKEKVN
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaggattatttagagttattatctcaaaagtaccccactatagacgatgct
tctgttgaaattattaatttaaaagctatatgcaaattaccaaagggtactgagtatttt
ttaagcgatatacatggagaatctgaaggctttgaatatttaataggcacttcatctggt
gttataaaagagaaaatagaaatattatttagaaatactttaacagaaaatgagagaata
gaacttcaaatacttatagtagatacaaagaatatgattaataaaaaagcatctaaagaa
gattttaatgattggtgcagaataactatatacagacttattagaatatgcaagcttgtt
actagcaaatatacaaggtcaaagattagaaagaagatgcctcagaactttgcttatata
cttgatgaacttttacaaacatctgttgaagacaataaagagaattattatttttctata
atagattctataatagatgtgtcggcatcagaaaagtttattatggcattatgtgctttg
ataagaaaatgcagtatagacaggcttcatattgtaggtgatatttatgacagaggacct
cacccagataaggtaattgagagtataatgaactttaatgaagttgacatggcttggggc
aatcatgatatacattggcttggggctgctaagggtagtttaatttgtgttgctaatgct
gttcgtttggctgtgagatataataattttgatttgcttgaatatagttatggcataaat
ttaagggctttatcatcatttgctaatgaggtttataaagatgacccttgcgaagtgttt
aaacctaatactctagataaaaatatatatgatgaggttgataaagatttagcttcaaag
atgcataaggctatatcaataatacagtttaagttggaatgtcagcttataaaaagacac
ccaaattatgctatggacgaacgtatacttcttgataagattgattataaaaaaggtact
attaatattgacggtaaaacctatgagcttaaagataaaaacttcccaacaataaatcct
aaaaacccttttgagcttacagaaggagaaaatactttaatacagagtttagctttttct
tttatcaatagcccaacacttcaaaagcatactaattatatttatgctaaaggcggaata
tataaaatatttaatggaaatcttctttatcatggatgcatacctacaaaagaagacggc
agttttgatgatgtatatatagacggacaatatttatctggaaagagatatttaaagcaa
gttgaagacaaggtgcgtaaagcattttactgcgaagttggaagcgaagaacagcttaat
gctttggattattgctggtatttatggtgcggtccaaaatctccattattcggtaaaaat
aaaatgacaacctttgaaagatattttatagaagataaagaaactcataaagaaagttat
aattcatattattatcatatagacaaaaaagattattgcgagagcatattaaaagagttt
gatttggatatacataaatcacatatagttaatgggcatgtacctgtaaagactcataaa
ggtgaaagcccaattaaaggcggtggaatacttttagtaatagacggaggactttctaag
gcttatcataaaagcacaggcataggaggctacactttaatatcaaactccaatgccatg
attatagcagagcatagaccttttgctgaagtagtagaatctggttttagaatatctcca
aaaacaactatagtagataggtttgtaactagaattacagtaggtgaaactgatattggt
attggcttaaacaaaagaataagtgatttggaagaattactcaatgcatatagaaacggt
atagtaaaagagaaggtgaattga

DBGET integrated database retrieval system