KEGG   Brachyspira pilosicoli P43/6/78: BPP43_11105Help
Entry
BPP43_11105       CDS       T02387                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPP43_11105
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BPP43_11105
Enzymes [BR:bpip01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BPP43_11105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2321084..2321950)
Genome map
AA seq 288 aa AA seqDB search
MSKTIRLIYPQWQGGIISHWIPELKPEDSSRGYYLGSKLLSILAPQNDNHKTLEVPVSLD
IKNREIKNGIMDYDFIVSQTKNALDILNKNNPDKIITFGGECSVSVVPFTYLNKKYDNNV
ALIWIDAHPDITLPEDNTYAGYHAMAVSACMGNVDKNISSILPSKISSDRILFVGLRDWE
RDDIKKRQEEYGIPHFSHEEASSENIINWLKKSNASKVLIHFDLDVLDPNEIIAAVGVSP
NGMKINETVRIINDIAKEREIVGFTIAEHMPRIEIMLKNMMEDLDLFK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactataagattgatttatccgcagtggcagggcggtattatttctcattgg
atacctgaactaaagcctgaagattcttcaagaggttattatcttgggtcaaaattacta
agcatacttgctcctcaaaatgataatcataaaactttagaagttcctgtttctttagat
ataaaaaatagagaaataaaaaatggtattatggattatgattttatagtatctcaaact
aaaaatgcattagatattttaaataaaaataatcctgataaaataataactttcggagga
gagtgttctgttagtgtagtgcctttcacatatctaaataaaaaatatgataataatgtt
gctttaatttggatagatgctcaccctgatattactttgcctgaagataatacttatgct
ggatatcatgctatggctgttagtgcttgtatgggtaatgttgataaaaatataagctct
atacttccaagcaaaatttcatctgatagaatattatttgtagggcttagagattgggaa
agagatgatataaaaaaacgtcaagaagaatacggcatacctcatttttctcatgaagaa
gcttcaagcgaaaatataataaattggcttaaaaaatctaatgcttctaaggttttgata
cattttgatttagatgtgcttgaccctaatgaaataatagctgctgtcggcgtttctcca
aatggaatgaagataaacgaaacagtaagaataataaatgatattgccaaagaaagggaa
attgttggctttactatagcagaacatatgccaagaattgaaataatgcttaaaaatatg
atggaagatttagacttatttaagtaa

DBGET integrated database retrieval system