KEGG   Brachyspira pilosicoli P43/6/78: BPP43_11705Help
Entry
BPP43_11705       CDS       T02387                                 

Definition
alkaline protease
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPP43_11705
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BPP43_11705
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BPP43_11705
Enzymes [BR:bpip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BPP43_11705
Exosome [BR:bpip04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPP43_11705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2449924..2451513
Genome map
AA seq 529 aa AA seqDB search
MIQLLPILLLSAFFIGCGQQPYTNLENTPKAKNVIVLIADGQSSDVITYSRWFKGGDSLA
IDEMLSGAVRTHNADSPIADSAPAGTALATGYKSSYQQFIGILPDEAILPNSSIPTEARA
PIANVLEAAQLLGKSTGVISTSEIMHATPAAFSAHDITRKDYDDLSEQQVFQDIDVILGG
GYKFFTKEARKDGKDLISEITNLGYSLIRTSDELDSFRGDKVVGLFADADLAYEIDREET
TQPSLAQMTSKAIDILSKNDKGFFLIVEASKVDWAAHANDPVGLVSDTLAYVDAVKAALD
FAKKDNNTMVIAVTDHGNSGFTMGNYDTSSDYHKRTLESFIEPVKKASRSAEYVARKIEA
GEDIKIAMQKYYAIDDMTEEEVNSLRGKTGDDLHYAIGPILAKRAYLGFSTHGHTGEDVP
LYTYLPNNKRIIGLIDNTDIAKNIASAMEINLDESTKKLFMSEDELKKAGVELTSDGNIL
TMHIGDKTAQIMKNRNIIIVNGERKTLDGVVVYNESKWYFPSQVLDILK
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgattcaattattacctattcttcttttatccgcattttttatcggatgcggtcaacag
ccttacactaatttagaaaacaccccaaaagctaaaaacgttatagtactaattgcagac
ggacaaagctctgatgtaatcacatactcaagatggtttaaaggcggcgattcattagca
atagatgagatgttaagcggagcagtgagaactcataatgctgattctcctatagccgat
tcagcacctgcaggtacagctttagctacaggctataaatcatcttatcagcagtttata
ggtatacttccagatgaagctatacttcctaattcatcaatacctacagaagcaagagct
cctatagcaaatgtgttggaggcagctcagcttcttggtaaatctacaggagtaatttct
acttcagaaattatgcatgccactcctgcagctttttctgctcatgacatcactagaaaa
gattatgacgacttaagcgaacagcaagtgtttcaagatatagatgttatattaggagga
gggtataagttttttactaaagaggctagaaaagacggaaaagatctaatatcagaaata
actaatttaggctattctctaattagaacttcagatgaattggattcttttagaggtgat
aaagttgtaggactttttgctgatgcagatttagcttatgagatagacagagaagagaca
actcagccttcattagctcaaatgacttcaaaggctatagatatactttctaaaaatgac
aaaggtttcttcttgattgtagaggcttcaaaagttgactgggcagctcatgctaatgac
cctgttggattagtttctgatactttagcttatgttgatgctgtaaaagctgcattagat
tttgctaaaaaagataataatactatggttatagctgtaactgaccatggaaacagcggt
tttactatgggtaattatgatacttcttcagattatcacaaaagaacattagaaagtttt
atagagcctgtaaaaaaagcttctcgttctgctgagtatgtggcaagaaaaatagaagct
ggagaagatataaaaatagctatgcaaaaatattatgctatagatgatatgacagaagaa
gaggttaattctcttagaggaaaaacaggcgatgatttacattatgctataggaccaata
ttagcaaaaagagcttatttaggtttcagcacacatggtcatactggagaagatgttcct
ctatatacatatttgccaaacaacaaaagaattataggacttatagataatactgatata
gctaaaaatattgcctctgctatggaaataaatttagatgaatctacaaaaaaattattt
atgagtgaagatgaattaaaaaaggcaggtgtggaattaacatcagacggtaatatactt
actatgcatattggagataaaactgctcaaataatgaaaaatagaaatataataattgta
aatggagagagaaaaactttagacggtgtagttgtttacaatgaatctaaatggtatttc
ccttctcaggttttagatatattaaaataa

DBGET integrated database retrieval system