KEGG   Brachyspira pilosicoli P43/6/78: BPP43_12020Help
Entry
BPP43_12020       CDS       T02387                                 

Definition
anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BPP43_12020
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BPP43_12020
Enzymes [BR:bpip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BPP43_12020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2519887..2520915
Genome map
AA seq 342 aa AA seqDB search
MAYLLILAQKKDSITEDEKYILELKKKYSYLSNYIDEVNSMSIEERRGLLTMVGITDTVL
SKETIKTLKDNHVSGVILFNYNIVDEEQLKKLTSDLKKYVNKNMLISIDEEGGEVFRIPF
DKYKDISAKMIGDSNSIEYAYNIAYNKAKFLKDMGINMILGPLCDVPSNKDSYIYNRSFS
TNVEMVSKMVEATIKAQKDAGIISVVKHFPGHGDTAVNSHSEFPIIDKTLEELKNKELIP
FQKAIDLGAEMVLVSHIKNKYIDDTLPASMSEKYRKLLEEDMGFKGVIITDDLVMTGKIE
STINYGINLTSNIYKNVKEMFRNIEPDIISCAKVLKIMRENT
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttggcttacttattaattcttgcacaaaaaaaagacagcatcacagaagatgaaaaatat
attttggaattgaaaaaaaaatattcttatttgtctaactatatagatgaagttaatagt
atgagcattgaagagaggagagggcttcttactatggtgggcatcactgacacagtatta
agcaaagagaccataaagacattaaaagataatcatgtttctggagttatactttttaat
tacaacatagtagacgaggaacaattaaaaaaactcacatcagatttaaagaaatatgtt
aacaaaaatatgttaatttctatagacgaagaaggaggcgaagtctttagaatacctttc
gacaaatacaaagacatttcagccaaaatgataggcgacagcaacagcattgaatatgca
tacaacatagcatataacaaagcaaagtttctaaaagatatgggtattaatatgatactt
ggtccgttatgcgatgtgccaagcaacaaagattcttatatatacaatagaagcttttct
acaaatgttgagatggtttcaaagatggtggaagctacaataaaagctcagaaagatgcc
ggtattataagcgttgttaagcattttcctggtcatggggacactgctgttaattcgcat
agtgagtttcctattatagataaaactttagaagagcttaaaaataaagaattaatacct
tttcaaaaggctatagatttgggtgctgagatggttttagtttcgcatataaaaaataaa
tatatagatgatacacttcctgctagcatgtcagaaaagtatagaaagttacttgaggaa
gatatgggttttaaaggggtgattattacagatgacctcgttatgacaggaaagattgag
agcactatcaattacggtataaatcttacaagcaatatttataagaatgtaaaagagatg
tttagaaatatagaaccagatataatttcatgtgctaaggtattaaagataatgagagaa
aatacctaa

DBGET integrated database retrieval system