KEGG   Brachyspira pilosicoli B2904: B2904_orf1126Help
Entry
B2904_orf1126     CDS       T02225                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B2904_orf1126 (folA)
   00670 One carbon pool by folate
    B2904_orf1126 (folA)
Enzymes [BR:bpj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     B2904_orf1126 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1154107..1154607
Genome map
AA seq 166 aa AA seqDB search
MIVSLIAAVDSKNGIGLNGVMPWGHIKEDMQFFRSTTTGYAVVMGRVTFESLGGKPLPNR
KNIVISSNKNELSNKYDNLFYDDNFENAISKLLLEKHNQIFIIGGESIYKRAMDYADKIY
LTHINKDYNCDRFFPEVDSKLFSSRILKNFVYDDIDVSIVEYTKDF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatagtatcattaattgctgctgttgattcaaaaaacggcataggcttaaatggtgta
atgccttggggacacattaaagaggatatgcagttttttagaagcactaccacaggatat
gctgttgttatggggagagttacttttgagtcattagggggaaagcctcttccaaataga
aaaaacattgttatatcatctaataaaaatgagctttcaaataaatatgataaccttttt
tatgatgacaattttgaaaatgctatttctaaattattattagaaaagcataatcaaata
tttattataggaggggagtccatttataaaagagcaatggattatgcagataaaatatat
cttactcatataaataaagactataattgcgatagattttttccagaagtagatagtaaa
ttattttcttcaaggatattgaagaactttgtttatgatgatatagatgttagtattgtg
gaatatactaaagatttttaa

DBGET integrated database retrieval system