KEGG   Brachyspira pilosicoli B2904: B2904_orf1210Help
Entry
B2904_orf1210     CDS       T02225                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B2904_orf1210
Enzymes [BR:bpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     B2904_orf1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1249974..1250525)
Genome map
AA seq 183 aa AA seqDB search
MSNIVVITAPSAAGKTTLIKKYMSKHSNAMFSVSHTTRNIREGEVDGKDYYFIDKDTFQK
MIDNGDFIEWANVHDNYYGTSFKELEKANNEKVILILDIDIQGALFLKEKGIHANYIFIE
PTSIDDLKARLEARGTESEESMKIRIQNAKRELEYKNKFDIVIKNDEIDVAYRQLEEAIN
SKL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatagtggtaataacagctccatcggcagctggtaaaacaactttaataaaa
aaatatatgtcaaaacactcaaatgcaatgttcagtgtgtctcatacaactagaaatatt
agagaaggtgaagttgacggcaaagattactactttatagataaagatactttccaaaaa
atgatagataatggcgattttattgaatgggctaatgttcatgataattattacggcact
tcttttaaagaattagaaaaggctaataatgaaaaagttatattaatattggatatagat
atacaaggagcattatttttaaaagaaaaaggaatacatgctaactatatatttatagag
cctacttcaatagatgatttgaaagcaagattagaggcaagaggaactgaatctgaagag
agcatgaagattagaatacaaaatgctaaaagagaattggaatataaaaataaatttgat
attgttataaaaaatgatgaaattgatgtagcttataggcaattagaagaagctataaat
tcaaaattataa

DBGET integrated database retrieval system