KEGG   Brachyspira pilosicoli B2904: B2904_orf1260Help
Entry
B2904_orf1260     CDS       T02225                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B2904_orf1260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B2904_orf1260
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B2904_orf1260
Enzymes [BR:bpj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B2904_orf1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1301081..1302337
Genome map
AA seq 418 aa AA seqDB search
MITSENGFFGEFGGRFVDEKLEKKLIELEEAFKFYIKDKDFLNELEELRSDFLGRPTPLM
YAKNISESIGGAKIYVKLEGFAHTGAHKINNSIGQALLAKRMGKKKIIAETGAGQHGIAT
AAACAKLGLECSIYMGDIDVRRQQPNVASMELYGANVVSVKRGSRGLKDAVDAALEEWIK
DLDDTHYLLGSAVGPSPYPDIVRTFQSIIGRELEKQIAEKNLKVKSMFACVGGGSNAIGF
FEPFIEKTDIELVAIEAGGIGSNIGENAVRMNNQYAKDHVAQGYKSKFILKENGEISDTM
SISAGLDYPGIGPQLAYLGDIGRIKFLSATDMEAINAVKEFAKHEGVIFALESAHAGAKA
IEYAKKCSKDDVIIVNMSGRGDKDIFITSPIFRAKRWKEFLQDELNRLENNIDIHNFK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgataacaagtgaaaacggtttttttggtgagtttggaggaagatttgtagatgagaaa
cttgaaaagaaattaatagaattagaagaggcttttaaattttatataaaagataaagat
tttttaaatgagctagaagagcttagaagtgattttttgggaagacctacaccattaatg
tatgctaaaaatatatctgagagtataggcggtgctaaaatatatgtaaaattagaaggt
tttgctcatactggtgcacataaaattaataactctataggtcaggcattattagcaaag
agaatgggaaagaaaaaaataatagcagaaacaggagcaggtcagcatggtattgctaca
gcggctgcttgtgctaagttgggattagaatgttctatatatatgggggatatagatgta
cgcaggcagcagcctaatgtggcatctatggaattatatggggctaatgttgtatctgtt
aaaagaggttctagaggattaaaagatgcagttgatgcggctttagaagaatggataaaa
gatttagatgatactcattatttacttggaagtgctgttggacctagtccttatccggat
atagttagaacttttcaatctataataggaagagaattagaaaaacaaatagcagaaaaa
aacttaaaagtaaaatctatgtttgcatgtgttggaggcggttctaatgcaataggtttt
tttgagccttttatagaaaaaactgatatagaattggtagctattgaagctggtggaata
ggttcaaatattggagagaatgctgtaagaatgaataatcaatatgctaaagaccatgtg
gctcaggggtataagagtaagtttatattaaaagaaaatggagagatatctgatactatg
tctatatcagcaggacttgattatcctggaattggacctcaattagcatatttaggagat
attggaagaattaaatttttaagtgctacagatatggaagctattaatgctgttaaagaa
tttgctaaacatgagggagttatatttgctttagagagtgctcatgctggtgctaaggct
attgaatatgctaaaaaatgctctaaagatgatgttataatagttaatatgtctggaagg
ggagataaagatatttttataacttctccaatatttagagctaagagatggaaagagttt
ttacaagatgaattaaatagattagaaaataatattgatatacataattttaaataa

DBGET integrated database retrieval system