KEGG   Brachyspira pilosicoli B2904: B2904_orf1429Help
Entry
B2904_orf1429     CDS       T02225                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase/aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bpj00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1483038..1483748
Genome map
AA seq 236 aa AA seqDB search
MATANRKDLAKSIIEACLNMRKDGVNQGTAGNISIRFKDGMLITPSGMPYEIMTPDDIVF
VDGNGKPEKDKIPSSEWRFHLSILKDNPTFNAVIHNHAIYSSMVSILNIDYIPAIHYMVG
VAGGNKIPCVKYATYGTQELCDNISKSMKGYKACILKNHGLLAADETLQKAYHVMMEVEN
LARLYMGVRGIGDYSILSDAEMEIVLEKFKNYGLNVKHKTKKTTKTTVKSSKSKKK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggctactgcaaacagaaaagatttagctaaaagcataatagaagcttgtttaaatatg
agaaaagatggtgttaatcaaggtactgctggaaacataagcataagatttaaagacggt
atgcttattacaccttcaggtatgccttatgagattatgacgcctgatgatattgttttt
gtagatggtaatggaaaaccagaaaaagataaaataccttcaagcgaatggagatttcat
ttatctattctcaaagataaccctacttttaatgctgtaatacataatcatgctatttat
tcatctatggtttctattttaaatatagattatattccagctattcattatatggtaggc
gttgctggaggaaataaaattccttgtgttaaatatgcaacatatggcactcaagaatta
tgcgacaatatttctaaatctatgaaaggatataaggcttgcatactcaaaaatcatgga
cttttagctgctgatgaaacattacaaaaagcatatcatgttatgatggaagttgaaaat
ctagctagattatatatgggagtaagaggtattggtgattactctattttatctgatgct
gaaatggaaattgttttagaaaaattcaaaaattatggtcttaatgtaaaacataaaact
aaaaaaacaacaaaaacaacagttaaatcttctaagtctaagaagaaatga

DBGET integrated database retrieval system