KEGG   Brachyspira pilosicoli B2904: B2904_orf1561Help
Entry
B2904_orf1561     CDS       T02225                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B2904_orf1561
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B2904_orf1561
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B2904_orf1561
Enzymes [BR:bpj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B2904_orf1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1617151..1618206)
Genome map
AA seq 351 aa AA seqDB search
MKAWNGLLREYREYLPITDKTPLITLHEGNTPLIKAEKIGKELGGIELYFKYDGLNPTGS
FKDRGMVMAVAKALEDGSKAIMCASTGNTSASAAAYAARSGIQCIVVIPDGNIALGKLAQ
ALMYGAKVIAIKGNFDEALKAVVDITNKYPITLVNSINPFRLQGQKTSAFEICDTLGKAP
DYLAIPVGNAGNISAYWMGFKEYKENGKVSNLPKMIGFEAEGSAAIVQNRVIENPQTLAT
AIKIGNPASWKLAVNAANESNGFIDSVTDDEILEAYKMLTREEGIFAEPASAASLAGVIK
TYKAGKLKKGDVVVSVLTGNGLKDPDNAIKICSAPIKVDNNIEEIRKAIGI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatggaacggacttttaagagaatatagagaatatttaccaattacagataaa
accccattaataacattgcatgaaggaaacactccattaataaaagcagaaaagatagga
aaagaacttggaggcatagaattatatttcaaatatgacggacttaaccctacaggttca
tttaaagacagaggaatggtaatggcagttgctaaggcacttgaagatggctcaaaggct
ataatgtgtgcttctactggaaacacttctgcatctgctgctgcctatgctgctagaagc
ggtatacaatgtatagtggttattccagatggaaatattgctttaggaaaattagcacag
gctttgatgtatggtgctaaggttatagctattaaaggtaattttgatgaagcattaaag
gctgttgttgatattacaaataaatacccaatcacattggtaaactctattaaccctttt
aggcttcaaggtcaaaaaacttctgcatttgagatttgcgatactttaggaaaagctcct
gattatttggctatacctgttggaaatgctggaaatatatctgcatattggatgggtttt
aaagaatataaagaaaacggaaaggtatcaaacttaccaaagatgataggttttgaggct
gaaggctctgctgctatagtacaaaacagagttatagaaaatcctcagacattggctact
gctataaagataggtaatcctgctagttggaagttagctgttaatgctgctaatgaatct
aatggttttatagactctgttactgatgatgaaatattagaggcttacaaaatgcttaca
agagaagagggtatatttgctgagcctgcttctgctgcttctttggctggagttataaaa
acttacaaagcgggtaaacttaaaaaaggtgatgttgtagtttctgtacttacaggaaat
ggacttaaagaccctgataatgcaataaagatttgttctgctcctataaaagttgataat
aatatagaagagataagaaaagctataggaatatga

DBGET integrated database retrieval system