KEGG   Brachyspira pilosicoli B2904: B2904_orf1586Help
Entry
B2904_orf1586     CDS       T02225                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpj00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bpj00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bpj00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1643002..1644351)
Genome map
AA seq 449 aa AA seqDB search
MSANIDLQESNFELLHLSGAWGRECHIKRRKLEQGMQSIGSVRGASGHGQNPFAALISPN
ADENNGEVYAMNFVYSGNFKASVEVDMHLNTRFQMGINDFDFGWTLMPNEEFQTPEAVLV
YTNKGLGDMSRTFHKLYQDCLMSKKYAYKERPILINSWESNYFDFNKESLLKLAKEAKNI
GAELFVLDDGWFGKRDDDKSSLGDWIPNEKKLGGSLSALIDDINKTGLSFGLWFEPEMVS
PDSDLFRKHPEWAIQVKGRKIETSRYQYVLDLSNPEVCGYIINFMTDILSKNNISYVKWD
MNRNITNLGSSYLKPEKQKEQSHRYMLGLYSVLENIVNAFPNILFESCAGGGGRCDAGML
YYMPQVWTSDDTDAIERLAIQYGASLIYPSISLACHISDIPNHQTHRKETIETRANVAMW
GNLGLELNLNKISEEDKKLYQKNWKFIKA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaatatagaccttcaggaatcaaattttgaattgcttcatttgtctggtgct
tggggaagagaatgtcatattaagagaaggaaattagagcaaggaatgcagtctatagga
agtgtgagaggtgcatcaggacatggtcaaaacccatttgctgctttaatatctcctaat
gctgatgaaaataatggggaagtatatgctatgaatttcgtatacagcggaaattttaaa
gcaagtgttgaagtggacatgcatttaaatactagatttcaaatgggaataaatgatttt
gattttggttggacattaatgcctaatgaagagtttcaaactcctgaagctgtgcttgta
tatacaaacaaaggtttaggtgatatgtcgagaacttttcataaactttatcaagattgt
ttgatgtcaaaaaaatatgcttataaagagcgtcctattttgataaacagttgggaatcc
aattattttgattttaataaagaaagtcttttaaaattagctaaagaggcaaaaaatata
ggagctgaattatttgtattagatgatggttggtttggaaaaagagatgatgataaaagt
tctttgggagattggatacctaatgaaaaaaaacttggcggaagtttgtctgctttgata
gatgatataaataaaactggattaagttttggattatggtttgaacctgaaatggtatct
cctgatagtgatttatttagaaaacacccagagtgggctattcaagttaaaggcagaaaa
atagagacttcaagatatcagtatgtattagatttaagtaatcctgaagtatgcggctat
ataataaactttatgactgatattttatcaaaaaataatatttcttatgttaaatgggat
atgaatagaaatattacaaatttaggttcatcttatctaaaacctgaaaagcaaaaggaa
caatctcatagatatatgttaggtctttacagtgtattagaaaatattgttaatgcattt
cctaatatattatttgaaagctgtgcaggtggcggcggaagatgtgatgctggtatgctt
tattatatgcctcaggtttggacaagtgatgatactgatgctatagaaagacttgctata
caatatggagcttctttaatttatccttcaatatctttagcttgccatatttctgatata
cctaatcatcaaacacataggaaggaaactatagaaacaagagcaaatgttgctatgtgg
ggtaatttgggattagaattaaacttaaataaaataagtgaagaagataaaaaattatat
cagaaaaattggaagtttataaaagcataa

DBGET integrated database retrieval system