KEGG   Brachyspira pilosicoli B2904: B2904_orf1626Help
Entry
B2904_orf1626     CDS       T02225                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bpj00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1690058..1691503)
Genome map
AA seq 481 aa AA seqDB search
MSDIRVRFAPSPTGFLHIGNARTALFNWLYAKSIKGKLILRIEDTDQERSTKEAVDMAIK
SLKWLGIDWDEGPEVGGNYGPYFQSERLDIYKKYTEKLMEEGKAYYCFCTSEELEKKSNM
QKTLNQPIIYDGKCKDIPLEEAKRRVANGEPAKIRFRVPKNQQIVFEDFVRGVVKTNSDE
IGDIIIVRENGFPTYNYAVVIDDMLMKISHVIRGEDHISNTPKQILIYEALGAEVPRFAH
TSSILGNDRKKLSKRHGAATLMEYKDEGFLPQAMRNFLALLGWTHPEAMENMNDEDMIKA
FTLDRFSKSPAIFDTAKLRHLNAWHIKNLDLDEATELFLPYLIQGGFLKENYTEEEHAWA
KKLISVIRHNCVVLSDIVKYVPVFFENDFELTDEMKEIVNKEESKKLLQFIKTNIENANE
ITDQYMKDLIKQAQKETGLKGPNLYHPIRYVITGSSAGTELSHICELLGKENILYRLSKY
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattagagttcgttttgctccatctccaactggttttttacatataggaaat
gcaagaacagcgttatttaattggctttatgctaaatctataaaaggaaaattaatttta
agaatagaagatacagatcaagagagaagcacaaaagaagccgttgatatggctataaaa
tcattaaaatggcttggaattgattgggacgagggcccggaagttggcggaaattatggt
ccatattttcaatctgaaagacttgatatatataaaaaatacactgaaaaacttatggaa
gagggtaaggcatattattgtttttgtacttctgaagagttagaaaaaaagtctaatatg
cagaaaactctaaatcagcccattatttatgacggcaaatgtaaggatataccattagaa
gaggctaaaagaagagttgctaatggagagcctgctaaaataagatttagagtgcctaaa
aatcagcagatagtatttgaagattttgttaggggagttgttaaaactaatagtgatgaa
attggcgacattatcattgttagagaaaatggttttcctacttataattatgctgtagtt
atagatgatatgcttatgaaaatttctcatgttataagaggagaggaccatatatctaat
actccaaaacaaatacttatttatgaagcattgggagcagaagttcctagatttgctcat
acttcttcaatacttggtaatgatagaaagaaattatcaaaaagacatggtgctgctact
ttaatggaatataaagatgaaggattcttgcctcaagctatgagaaacttccttgcttta
cttggttggactcaccctgaagctatggaaaatatgaatgatgaagatatgattaaagca
ttcactttagatagattttctaagagtcctgctatatttgataccgctaaattaagacat
ttaaatgcttggcatattaaaaatcttgatttggacgaggctactgaattatttttacct
tatcttatacaaggcggcttcttaaaagaaaattatacagaagaagaacatgcttgggct
aaaaagcttatatccgtaataagacataattgtgttgttttatctgatattgttaaatat
gttcctgtattttttgaaaatgattttgagcttacagatgagatgaaagagattgtaaat
aaagaagaaagtaaaaagcttcttcagtttattaaaactaatatagaaaatgctaatgaa
ataactgaccaatatatgaaagatttaataaaacaagctcaaaaagaaactggtcttaaa
ggccctaatttgtatcaccctataagatatgtaataacaggaagcagtgctggtactgag
ttatcacatatatgcgagcttttgggtaaagaaaatattttatacagattatctaaatat
atataa

DBGET integrated database retrieval system