KEGG   Brachyspira pilosicoli B2904: B2904_orf1628Help
Entry
B2904_orf1628     CDS       T02225                                 

Definition
bifunctional pyrazinamidase nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    B2904_orf1628
Enzymes [BR:bpj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     B2904_orf1628
    3.5.1.-  
     B2904_orf1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1692290..1692931
Genome map
AA seq 213 aa AA seqDB search
MSKVKILTIVDMQNDYMEGGPMAVNGAIGLIPVINDLIKNGEYDAIIATQDWHPSNHISF
ASTHNKEPFSKIRVMDQETGDEDILTLWPRHCVARTFGSAIVDELKKKKDYIYVQKGVDA
DDEGVSGFSYMHKDFIDAARENKEVLILDFVGVALDYAVYYTARDTAQYVTSINAEYLVS
VNVLEYATAAMNPDKVYELYSNTKNINLKKVHL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggttaagatactaacaatagtagatatgcaaaatgattatatggaaggcggt
cctatggctgttaatggagcaattggacttatacctgtaattaatgaccttataaaaaat
ggagaatatgatgctataatagctactcaagattggcatccatcaaatcatatatctttt
gcttctactcataataaagaacctttttctaaaattagagtaatggaccaagaaactggc
gatgaagatattttaacactttggcctcgtcattgtgttgctagaactttcggctctgct
attgttgatgaattaaaaaagaaaaaagattatatttatgttcaaaagggtgttgatgct
gatgatgagggagtatctggattttcttatatgcataaggactttatagatgctgctaga
gaaaataaagaagtattgatattagattttgtcggtgttgctttggattatgctgtttat
tatacggcaagggatacagctcaatacgtaacttctattaatgctgaatatttagttagc
gtaaatgttttagaatatgcaactgcagcaatgaatccagataaagtatatgaattatat
tccaatacaaaaaacattaatcttaaaaaggttcatctgtga

DBGET integrated database retrieval system