KEGG   Brachyspira pilosicoli B2904: B2904_orf1638Help
Entry
B2904_orf1638     CDS       T02225                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B2904_orf1638 (recR)
DNA repair and recombination proteins [BR:bpj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      B2904_orf1638 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1700299..1700907)
Genome map
AA seq 202 aa AA seqDB search
MSGIDSLDKLTQMIARLPGIGGRSAMRIALYLFDSDDEYLSELSNSILSLHKNIKLCREC
YSLSENDICNICASDKRDRTKLCIVESYTDMIAIEKTEEYNGIYHVLGGLIEPLKGIGIS
DIRIKELIDRVKDNSSIEEIIIAFGASLEADTTASYINKTLRNNNFDKKISRITYGISLA
SDIENADSRSLARSIADRVVMQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggtattgattctttagataagcttacacagatgatagctagacttcctggaata
gggggaaggagtgctatgcgtattgctttgtatttgtttgacagtgatgatgaatattta
agcgagttatctaattctattttgtcgctgcataaaaatataaagctttgcagagaatgt
tattctttgagtgagaatgacatttgcaatatatgtgcaagtgataaaagagacagaaca
aagctatgcatagttgaatcttatacagatatgattgccatagaaaaaacagaagaatac
aatggtatttatcatgttttaggaggattaatagagcctcttaaaggaataggtatttca
gatataagaataaaagaattaatagatagagttaaagataatagctcaatagaagaaatt
attatagcatttggtgcttcattagaggcagatactacagcatcgtatataaataaaact
ttaagaaataataattttgataaaaaaataagccgcattacatatggtatatcattagca
agcgatattgaaaatgctgattcacgttcattagcaagaagcattgcagacagagtagtt
atgcagtag

DBGET integrated database retrieval system