KEGG   Brachyspira pilosicoli B2904: B2904_orf1762Help
Entry
B2904_orf1762     CDS       T02225                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    B2904_orf1762 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    B2904_orf1762 (bsaA)
Enzymes [BR:bpj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     B2904_orf1762 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1820141..1820494)
Genome map
AA seq 117 aa AA seqDB search
MQDLYKKYKKDGFEILDFPCNQFGGQAKEPIEEIAEFRKEKYGVTFKLFDKVKVNSKNAD
PLFTYLRTEKPTEEGVDKIRWNFGKFLIDRQGNIVGRYDPRVKPEELDEIVSELLKK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggatttatacaaaaaatataaaaaagatggttttgaaatattagactttccatgt
aatcaattcggcggacaggcaaaagagcctattgaagaaattgctgagtttagaaaagaa
aaatacggcgttacttttaagttgtttgataaagtaaaagttaatagcaaaaatgctgac
cctttatttacttatttaagaaccgaaaaaccaactgaagagggtgttgataaaataaga
tggaattttggtaaatttttaatagataggcaaggcaatatagtagggcgttatgaccct
agggtaaaacctgaagaactcgatgagatagtatcagagttattaaaaaaataa

DBGET integrated database retrieval system