KEGG   Brachyspira pilosicoli B2904: B2904_orf1765Help
Entry
B2904_orf1765     CDS       T02225                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    B2904_orf1765
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B2904_orf1765
Enzymes [BR:bpj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     B2904_orf1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1821305..1822828)
Genome map
AA seq 507 aa AA seqDB search
MKYFKNLIKGYDNLNIKEITKESLKLEIKSIAYNSKLVKKNYIFVAIKGLKDDGHKYIES
AIKNKASIIIYDISADKSFINSLKEKYKNVCFVGSKNPRETLAYMSAKLYDEPTKKMHSI
AITGTNGKTTTSYLLKAALESAKNKIALIGTIKNMIGKSEIKTNLTTPESIDLESIFDKA
YKKNVSHIVMEASSQALAMDRCDYINYDAAIFTNLTEDHLDYHIDMKNYLKAKLKLFSLL
KQSSKKKKLAIINISTDYFKEIKNYIKKLDLKMVTYGLNEKADYYAKIITLNSKYSEYEF
YAKGKFISKVKLSLLGEFNVVNSLSVLAYAYEYKLDIEKVIKAIRKVQVSGRFEIVSGEK
CPFIVAVDYSHTPDSLENILVESRKLKPNRVIVVFGCGGDRDRKKRPIMASIAEKYADIS
ILTTDNQRTESIEQIMSDIEKGFTHSNYKKIIDRKEAIFEAIKEAKENDIVIIAGKGHET
YQIFPDKTIHFDDTEVAREALSNIDKC
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattttaaaaatcttataaaaggctatgataatttaaatattaaagaaataaca
aaagaaagcttaaaattagaaataaaatccatagcttataattcaaaacttgtaaaaaaa
aattatatatttgttgctattaaaggcttaaaagatgatggtcataaatatatagaaagt
gccattaaaaataaagcaagtattattatttatgacatttctgcagataaaagttttatt
aacagtctaaaagaaaaatataaaaatgtttgttttgtaggaagtaaaaatccaagagaa
actttagcatatatgtctgctaaactctatgatgagcctacaaaaaaaatgcattcaata
gctataacaggaactaacggaaaaactactacaagctatctattaaaagccgcattagaa
agtgctaaaaataaaatagctctaataggcactataaaaaatatgataggcaaatcagaa
ataaaaactaacctcacaactccagaatctatagatttagaaagtatttttgataaagca
tataaaaaaaatgtttctcatattgtaatggaagcttcttctcaggcacttgctatggat
agatgcgattatattaattatgatgctgcaatatttacaaatctcacagaagaccatttg
gattatcatattgacatgaaaaattatttgaaggctaaattaaaattattttctctgctt
aaacaaagctctaaaaagaaaaaattggctattataaatataagtacagattattttaaa
gagataaaaaattatataaaaaaattagatttaaaaatggttacttacggcttaaatgaa
aaagctgattattatgccaaaattataactctaaactcaaaatatagtgaatatgagttt
tatgctaagggaaagtttatatcaaaagtaaagctatctcttttgggagagtttaatgtt
gttaattctttatctgtattagcttatgcatatgaatataaattagatatagaaaaagta
ataaaagctattagaaaggttcaggtttctggaaggtttgaaatagtgagcggtgagaaa
tgtccttttattgtggctgttgattattctcatacgccagatagtttagaaaatatatta
gtggaatctagaaaattaaaacctaatagggtgatagtggtatttggctgtggaggggac
agagacaggaaaaaacgtcctataatggcttctattgcagaaaaatatgctgatatatct
atactaactacagataaccaaagaactgaaagcatagagcaaataatgtctgatatagaa
aagggttttactcattctaactacaaaaaaataatagacagaaaagaagctatatttgag
gcaattaaagaagcaaaagaaaatgatatagtgataatagcaggcaaaggtcatgaaacc
tatcaaatattcccagataaaactattcattttgatgatactgaagttgctagagaagca
ttatcaaatatagataaatgttag

DBGET integrated database retrieval system