KEGG   Brachyspira pilosicoli B2904: B2904_orf2004Help
Entry
B2904_orf2004     CDS       T02225                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B2904_orf2004 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    B2904_orf2004 (proB)
Enzymes [BR:bpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     B2904_orf2004 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2050580..2051734
Genome map
AA seq 384 aa AA seqDB search
MFCMKNIDLNNIKRIVFKFGTNVLRNDEGYISLARIYSFIEAIAKYKKMGKEVLVVTSGA
VGLGAKKINATDLSEVSLKQACAAIGQSQLMSIYEDGFSKFDIVTAQILLTEEDFSNRRR
YLNLRSTLDTLLKYNVIPIINENDTVSSDELKLLYDVTQISFSDNDKLSALVASELDADL
LIILSDINGLYDDNPKTNPNANFIYEVFEVTKEIESLGLDASKGGRGGMKTKLQAAKIVT
RSGCGLIIANGKTPNILNNIFNTKKKTIFYPVEENNELNTKKRWIAYATTIIGKLVVNAG
AKKAIIEKESSLLPIGVTKVVNNFKKGDIVSIIDEDGEEFARGIINYNSEDTNKIIGKHS
DSILEILGYKNYDALITRDYIVLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcatgaaaaatatagatttaaacaacataaaaagaatagttttcaaatttgga
actaatgtattaagaaatgatgaaggatatatttctttagctagaatatattcttttata
gaggctatagctaaatataaaaaaatgggcaaagaagttttagttgttacatctggagct
gttggcttgggagcgaaaaaaattaatgcaacagatttaagcgaagtatcactaaaacaa
gcatgtgctgcaattgggcaatcacagcttatgtctatttatgaagatggattttcaaag
tttgatattgttacagcacagattctacttacagaagaagacttttcaaacagaagaaga
tatttaaaccttcgctctacattagatacattattaaaatacaatgtaatacctataatc
aatgaaaatgatactgtttctagtgatgagcttaaattattatatgatgttactcaaata
agtttttctgataatgataaactatctgcattagtagcaagtgagcttgatgctgattta
cttataatactttctgatatcaatgggctttatgatgataaccctaaaactaacccaaat
gctaattttatatatgaagtttttgaggttacaaaagagatagaaagtttaggtcttgat
gcttctaaaggcggaagaggcggaatgaaaacaaaattgcaggctgccaaaattgttaca
aggtcaggctgcggtttgattattgctaatggaaaaactccaaacattttaaataatata
ttcaatacaaaaaaaaaaactatattctaccctgtagaagaaaataatgaacttaacaca
aaaaaaagatggattgcttatgctacaactattataggaaaacttgttgtaaatgctggt
gctaaaaaagctataatagaaaaagaatctagtcttcttcctattggagtaacaaaggtt
gtaaacaattttaagaaaggcgacattgtaagcattatagatgaagatggtgaagagttt
gcaagaggcattattaattataattctgaggatacaaataaaataataggcaaacattct
gattctatattagagatattaggctacaagaactatgatgctctaattacaagagattat
atagtgttattataa

DBGET integrated database retrieval system