KEGG   Brachyspira pilosicoli B2904: B2904_orf2027Help
Entry
B2904_orf2027     CDS       T02225                                 

Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B2904_orf2027
   01230 Biosynthesis of amino acids
    B2904_orf2027
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2904_orf2027
   00051 Fructose and mannose metabolism
    B2904_orf2027
   00562 Inositol phosphate metabolism
    B2904_orf2027
Enzymes [BR:bpj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     B2904_orf2027
Exosome [BR:bpj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   B2904_orf2027
  Exosomal proteins of bladder cancer cells
   B2904_orf2027
  Exosomal proteins of melanoma cells
   B2904_orf2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2075195..2075953)
Genome map
AA seq 252 aa AA seqDB search
MRRKLIAGNWKMNNTNKEALELVNQLKDLVKDVKDRDIMIAPTFTCLSDVNNAIKGSNIK
LGAQNLYFEEKGAFTGQISADMLLSVGCEYVIVGHSECRDIFGEKDELINKKVKRALDKN
LVPVLCVGEHLEEREKGITSDIVSSQVKEAFKGLSEAEAKKVVIAYEPVWAIGTGKTATP
QDADDVHKTIRDTLKSIYNESVSEGMIILYGGSVNEKNADDLLNMPNIDGALVGGASLVA
DKFARIVNYIAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaaaacttatagctggtaactggaaaatgaataatactaacaaagaggctttg
gagttagtaaatcagttaaaagatttagtaaaagatgttaaagacagagatattatgata
gcacctacttttacttgcttgagcgatgttaataatgctattaaaggaagcaatataaaa
ttaggagcacagaatttatattttgaagagaagggtgcttttactggtcagatttctgct
gatatgcttttgtctgtaggctgtgaatatgttatagttggtcactctgaatgccgtgat
atatttggtgaaaaagatgagcttataaacaaaaaagtaaaaagagctttagataaaaac
ttagtacctgttttgtgtgtaggtgaacatttagaagagagagaaaaaggcattacttct
gatatagtaagcagtcaagtaaaagaggcttttaagggtttaagtgaagctgaggctaaa
aaggttgtaatagcttatgaacctgtttgggctattggtactggtaaaactgctactcct
caagatgctgatgatgtacataaaactataagagacacattaaaatctatttataatgag
agtgtttctgaaggcatgattatactttacggcggaagcgttaatgagaaaaatgctgat
gatttgcttaatatgcctaatatagatggtgctttagttggcggtgcttcattagttgct
gacaagttcgctagaatagttaattatatagctaagtaa

DBGET integrated database retrieval system